Conserved Protein Domain Family
fabG

?
PRK05653: fabG 
3-ketoacyl-(acyl-carrier-protein) reductase; Validated
Statistics
?
PSSM-Id: 235546
View PSSM: PRK05653
Aligned: 324 rows
Threshold Bit Score: 176.889
Threshold Setting Gi: 22298474
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 54024006    9 EGKVALVTGAARGQGRAHAVRLAADGAD--I-IAVDVCapVSDtvtypapteADLAETARLvEAAGRKVLTRvVDIRDLA 85
gi 86605620    5 QGRQILVTGGTGGLGLGVTPVLLDTGAE--L-TLTYRQ--EEE---------LAVLRQRLPaNSLDQVRFVQ-VDLLNEA 69
gi 86608464    5 QGKQILLTGGTGGLGLGVVPVVLASGAE--L-TLTYRQ--EKD---------LAILRERLP-ANALDRVRFVqVDLTDEA 69
gi 298490645   2 KGKQVLLTGGTGGLVLGVTPAVLAQGAE--V-TIPYRS--PKD---------VECLKGIISpADIARIHFIP-ANLEDEA 66
gi 75908116    2 KGRQVLLTGGTGGLGVGVTPVVLAQGAN--L-TITYRN--LKE---------VERLKEVLPpADFARVTFLP-ANLEEES 66
gi 17231297   22 KGRQVLLTGGTGGLGLGVTPVVLAQGAN--L-TITYRN--LKE---------VERLKEVLPpADFARVNFLP-ANLEEES 86
gi 37523924    2 QGRHVLLTGGTGGLGLGVTPAVLARGAHltIpFIAQRE--------------VERLKSRLCpADLSRVRFVE-ANLAEEA 66
gi 220908813   2 ATKQVLITGGTGGLGLGVVPVFLSQGAEitLpVRNAQS--------------GERLKGLLSpAELVRIRLVP-TDLSQES 66
gi 22298474    9 QHRAVLVTGGTGGLGQGVVPVLLSHGYT--L-TIPYID--GTA---------RVALEKQLAaAELANVRFVA-ADLNNES 73
gi 158336244   2 RNSQVLITGGTGGLGLGVTPKVLATGAE--V-TLPYIV--ESE---------VERLKHILSpAELVRTHFVP-TDLGKEA 66
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 54024006   86 ALQDVVADGVAMfgrlDVLVANAGVLSWGRLWELSEDAWDTVVDVNLNGTWRTVRAVVPAMIEAGNgGSIVIVSSSAGLK 165
gi 86605620   70 AVARLIDDLPRV----DGLVHLVGGFAMGPTHEYSLEDWRRDFDLNLTTTFLACKHSLRKMWQQGY-GRIVTVASRGAVE 144
gi 86608464   70 AVARVIADLPRV----DGLIHLVGGFAMGPTHEYSLADWYRDFDLNLTTTFLTCKHSLRRMWQQGY-GRIVTVGSRGAVE 144
gi 298490645  67 SVDKLISRMTKV----DVLIHLVGGFSMGKTHEYSFYDWKRVSELNLNTTFLTCKYSLKSMLENGY-GRIVTVSSRAGAE 141
gi 75908116   67 SVDNLITRIGRV----DVLIHLVGGFSMGKIHEYSYYSWKREFDINLNTTFLVCKYSLKSMLDHGY-GRIITIGSKAAVE 141
gi 17231297   87 SVDNLITRIGRV----DVLIHLVGGFSMGKTHEYSYYSWKREFEINLNTTFLVCKYSLKSMLDHGY-GRIITIGSKAAVE 161
gi 37523924   67 SVEGLLAALERV----DVLIHLVGGFNMGPTHQYTYADWKRDIELNLDTTFLLCKHCLGRMLATGY-GRIVTVGSRGALE 141
gi 220908813  67 EVEQLINGMSRI----DALVHLVGGFSMGKTHEYSYADWQRMLELNLNTAFLVCKHSLNKMWQQQY-GRIVTVGSRGAVE 141
gi 22298474   74 EVAALVERMPQL----DAVVHLVGGFSMGATAQFALSDWQQSFRLNVETTFLVCKHALKRMQAQQY-GRIVTIGSRGAVE 148
gi 158336244  67 SVAELVEGMDRV----DALIHLVGGFSMGKTHEYAFEDWQRDLNLNLNTTFLVCKHSLKRMLQHHY-GRIVTVGSRGAVD 141
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 54024006  166 ATPGNGHYAAAKHGLVALTNTLALEAGEFGIRVNSIHPYSVDTPMIqpdammemfgKHPAYLHAFPPVPLrqaadgkSGF 245
gi 86605620  145 PGSQLAAYCASKAGVVALTRTIAAETKGTDITANVILPSIIDTPA-----------NRAAMGSEQAELWV---------- 203
gi 86608464  145 PGPQLAAYCASKAGVVALTRTIAAETKGTDITANVILPSLIDTPA-----------NRAAMGSEQAELWV---------- 203
gi 298490645 142 PAGQLAAYSAAKAGVIALTKVIADETKGTNITANSVLPNFIDTPTNr---------EEMGADNADKWVKP---------- 202
gi 75908116  142 PSGGLAAYSAAKAGVVAFTKAIADETKGTNITANVILPTIIDTPANr---------QAMGTENADKWVKP---------- 202
gi 17231297  162 PSGGLAAYSAAKAGVVAFTKAIADETKGTNITANVILPTVIDTPANrqamg----------------------tenaDKW 219
gi 37523924  142 PAGQLAAYSAAKAGVVALTKAIAAETKGTGITANVVLPSVIDTPGNraamg----------------------aenaDKW 199
gi 220908813 142 PAGQLAAYCAAKAGVVALTRSIADETKGSNITANVVLPGVIDTPGnqaa------------------------mgahPEW 197
gi 22298474  149 PAAELAAYCAAKAAVVAFTRAIAAETKGKNITANVILPSIIDTPANr---------AAMGEAQAAHWVSP---------- 209
gi 158336244 142 PGGQLAAYCAAKAGVVALTKAIADETKGTNITANTVLPSIIDTPTNre-------aMGENNA---------------DQW 199
                        250       260       270
                 ....*....|....*....|....*....|..
gi 54024006  246 MPVDQVADVVSWLAGPGSGVITGTQVPVDAGA 277
gi 86605620  204 -KPESIGQVIAFLVSEAARDLRGAAIPVYGNV 234
gi 86608464  204 -KPESIGQVIAFLVSEAARDLRGAVIPVYGNV 234
gi 298490645 203 ---ESIAQFSCFLASEAAKDVRAAAVPVYGNI 231
gi 75908116  203 ---ESIGELICFLASEKAKDIRGAAIPIYGGV 231
gi 17231297  220 VKPESIGELICFLASEKAKDIRGAAIPIYGGV 251
gi 37523924  200 VKPESLAEVICFLASEAARDVRGAAVPVYGSV 231
gi 220908813 198 VKPESLAQVIAFLASEAAGDLRGAVIPVYGNS 229
gi 22298474  210 ---AAIAELIAYLISEGAAAISGAVIPIYGNA 238
gi 158336244 200 VKPESLADVICFLASDAAQDVRGAAIPVYGNA 231
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap