Conserved Protein Domain Family
PRK05452

?
PRK05452: PRK05452 
anaerobic nitric oxide reductase flavorubredoxin; Provisional
Statistics
?
PSSM-Id: 235475
View PSSM: PRK05452
Aligned: 81 rows
Threshold Bit Score: 916.07
Threshold Setting Gi: 237808579
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 145301103   1 MTIHVKNNIHWVGQRDWEVRDFHGTEYKTHKGTSYNSYLIREGKNVLIDTVDHKFSREFVQNLAAEIDLASIDVIVINHA 80
gi 157377185   1 MAIHVKNNIQWVGQRDWEVRDFHGTEYKTEKGTSYNSYLIQEEKTVLIDTVDHKFSHEFVQKLEMEIDLKQIDYIVINHA 80
gi 212633941   1 MTIHVKNNIHWVGQRDWEVQDFHGTEYKMTRGTSYNSYLIREQKTVLIDTVDHRFSHQFIQNLEMEIDLNSIDFIVINHA 80
gi 54308337    1 MSIHVKNNIHWVGQRDWEVRDFHGTEYKTLKGTSYNSYLIREGKNVLIDTVDHKFSYDFVQQLEQEIDLNEIDLIVINHA 80
gi 218677179   1 MTIHVKSNVHWVGVHDWETEHFHGKEYHMNKGTSYNSYLIREEKTVLVDTVDHRFTEQFLANLEMEIDINEIDYIICQHA 80
gi 37675841    1 MTIHVKNNIHWVGQRDWEVQDFHGTEYKMTKGTSYNSYLIREEKTVLIDTVDHRFSQQFIQNLQMEIDLQSIDFIVINHA 80
gi 27367713    1 MTIHVKNNIHWVGQRDWEVQDFHGTEYKMTKGTSYNSYLIREEKTVLIDTVDHRFSQQFIQNLQMEIDLQSIDFIVINHA 80
gi 262396596   1 MTIHVKNNIHWVGQRDWEVQDFHGTEYKMTKGTSYNSYLIREEKTVLIDTVEHRFSQQFIQNLEMEIDLKTIDFIVVNHA 80
gi 209695636   1 MTIHIKNNVNWVGQRDWEVSDFHGTEFKMTKGTSYNSYLIQEEKTILIDTVDHRFSHQFIQNLEMEIDLTSIDYIVINHA 80
gi 59712389    1 MTIHIKNNVNWVGQRDWEVSDFHGTEFKMTKGTSYNSYLIQEEKTVLIDTVDHRFSHQFIQNLEMEIDLASIDYIVINHA 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 145301103  81 EEDHAGALTELMARIPGTPIYCTHNAIDSITGHHHHPEWNFHPVKTGDSLDIGNGKQLVFIETPMLHWPDSMMTYMTEDA 160
gi 157377185  81 EEDHAGALAVLLAKIPGTPIYCTENAIDSITGHHHHPEWNFHIVKTGDSLDIGNGKQLIFIETPMLHWPDSMMTYMTGDA 160
gi 212633941  81 EEDHSGALTALMQKIPGTPIYCTEAAVDSIVGHHHHPEWNFKTVKTGDSVDIGNGKQLIFIEAPMLHWPDSMMTYMTEDA 160
gi 54308337   81 EEDHAGALSVLLSKIPNTPIYCTENAIDSITGHHHHPEWNFNVVKTGDSIDIGNGKSLVFIETPMLHWPDSMMTYMTGDA 160
gi 218677179  81 EEDHSGALSALLAKIPNTPVYCTEAGVNSIVGHHHQPDWNFRTVKTGDTLDVGNGKQLIFVEMKMLHWPDSMATYLTGDE 160
gi 37675841   81 EEDHSGALSALMEKIPNTPIYCTEAAIDSIVGHHHHPEWNFKTVKTGDSIDIGNGKQLVFVEAPMLHWPDSMMTYLTGDA 160
gi 27367713   81 EEDHSGALSALMEKIPNTPIYCTEAAIDSIVGHHHHPEWNFKTVKTGDSIDIGNGKQLVFVEAPMLHWPDSMMTYLTGDA 160
gi 262396596  81 EEDHSGALSALMEKIPNTPIYCTEAATDSIVGHHHHPEWNFKTVKTGDSIDIGNGKQLVFVEAPMLHWPDSMMTYLTGDA 160
gi 209695636  81 EEDHAGALAALMEKIPGTPIYCTENAIDSIVGHHHHPEWNFKPIKTGDALDIGNGKQLVFVEAPMLHWPDSMMTYLTGDA 160
gi 59712389   81 EEDHSGALAALMEKIPGTPIYCTENAIDSIVGHHHHPEWNFNPIKTGDALDIGNGKQLIFVEAPMLHWPDSMMTYLTGDA 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 145301103 161 VLFSNDAFGQHYCDEHLFNDEVDQTELMEQCQRYYANILTPFSPLVTAKIKEVLGFNLPVSMVATSHGIVWRDDPTQIIL 240
gi 157377185 161 VLFSNDAFGQHYCDERLFNDEVDQTELMDQCLRYYANILTPFSPLVTAKIHEVLSFNLPVDMIATAHGVVWREDPTQIIH 240
gi 212633941 161 VLFSNDAFGQHYCDEHLFNDEVDQNELKEQCLRYYANILTPFSSLVTAKIHEVLSFNVPVDMIATAHGIVWRDNPTQIIH 240
gi 54308337  161 VLFSNDAFGQHYCDERLFNDEVEQNELMEQCLRYYANILTPFSPLVTAKIHEVLSFNLPVDMVATSHGVIWRDNPTQIIE 240
gi 218677179 161 ILFSNDAFGQHYCDENLFNDQLDQVELHDQCLRYFSNILTPFAPLVKAKIEEVLSLGVPIDVIATSHGCIWRDNATQIVE 240
gi 37675841  161 VLFSNDAFGQHYCDERLFNDEVDQAELMEQCLRYYSNILTPFSALVTAKIQEVLSFNLPVDMIATSHGIVWRENPTQIIE 240
gi 27367713  161 VLFSNDAFGQHYCDERLFNDEVDQAELMEQCLRYYSNILTPFSALVTAKIQEVLSFNLPVDMIATSHGIVWRENPTQIIE 240
gi 262396596 161 VLFSNDAFGQHYCDERLFNDEVDQNELMEQCLRYYSNILTPFSSLVTAKIKEVLSFNLPVDMIATSHGIVWRDNPVQIIE 240
gi 209695636 161 ILFSNDAFGQHYCDERLFNDEVDQTELMDQCLRYYANILTPFSALVTAKIKEVLSFNLPVDMIATSHGCVWRDNPTQIIH 240
gi 59712389  161 ILFSNDAFGQHYCDERLFNDEVDQTELMDQCLRYYANILTPFSALVTAKIKEVLSFNLPVDMIATSHGCVWRDNPTQIIH 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 145301103 241 KYLEWADHYQEDRITLFYDSMSNNTRMMADAIAQGIHEVDPGVAVKIYNVARHDKNEILTQVFRSKGVLVGSSTMNNVMM 320
gi 157377185 241 KYLEWADEYQEDRITIFYDSMSNNTRMMADAIAQGIHDVDPKVAVKIFNVSRHDKNEILSNLFRSKGVLVGSSTMNNVMM 320
gi 212633941 241 QYLEWADSYQEDKITIFYDSMSNNTRMMADAIAQGIHDVDPGVAVKVFNVSKHDKNEILSHTFRSKGVLVGSSTMNNVMM 320
gi 54308337  241 QYLEWANEYKEDKITIFYDSMSNNTRMMADGIAQGITETDPNVAVKIFNVSRHDKNEILTNVFGSKGILVGSSTMNNVMM 320
gi 218677179 241 QYYEWSKAYKEDRITIVYDTMSNNTRMMADAIAKGIRKGSPETAIKVFNISKHDKNDILANIFRSKGVLVGSSTMNNVMM 320
gi 37675841  241 QYLAWANNYQEDRITIFYDSMSNNTRMMADAIAQGIHDVDPSVAVKVFNVSKQDKNEILANVFRSKGILVGSSTMNNVMM 320
gi 27367713  241 QYLAWANDYQEDRITIFYDSMSNNTRMMADAIAQGIHDVDPSVAVKVFNVSKQDKNEILANVFRSKGILVGSSTMNNVMM 320
gi 262396596 241 QYLEWADNYQEDRITIFYDSMSNNTRMMADAIAQGIHDVDPSVAVKVFNVSKHDKNEILANVFRSKGILVGSSTMNNVMM 320
gi 209695636 241 QYLEWADNYQEDRITLFYDSMSNNTRMMADAIAQGIHDVDPGVAVKVFNVSRQDKNDILTSVFRSKGILVGSSTMNNVMM 320
gi 59712389  241 QYLEWADNYQEDRITIFYDSMSNNTRMMADAIAQGIHDVDPAVAVKVFNVSRQDKNDILTSVFRSKGILVGSSTMNNVMM 320
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 145301103 321 PKVAGMLEEITGLRFRNKRASAFGSYGWTGGAVDRIQTRLMDAGFDISISLKAKWRPDGSALALCREHGRQLARQWAL-- 398
gi 157377185 321 PKVAGMLEEITGLRFKNKKAGAFGSFGWNGGAVDRIHTRLTDAGFETLLGLKTKWRPDGKALLECREHGKEVARQWAL-- 398
gi 212633941 321 PKIAGMLEEITGLRFKGKKAAAFGSYGWNGGAVDRINTRLMDAGFETALGLKTKWRPDGKAMRECREHGRQIAKQWAL-- 398
gi 54308337  321 PKVAGMLEEITGLRFKGKKAGAFGSYGWNGGAVDRIHSRLTDAGFFTTVGLKTKWRPDSNAMEECREHGRKIAREWAL-- 398
gi 218677179 321 PQIAALLEEIHGLRFAGKRAAAFGSSGWTGGAVKRIDARLHEANFEVSAPQHIHWKPDTDALRQCIDYGMTLAEVWRVea 400
gi 37675841  321 PKIAGMLEEITGLRFKAKKAAAFGSYGWNGGAVDRIHARLTDAGFETAISLKTKWRPDGKAMRECREHGQQIAKLWAVkd 400
gi 27367713  321 PKIAGMLEEITGLRFKAKKAAAFGSYGWNGGAVDRIHARLTDAGFETAISLKTKWRPDGKAMRECREHGQQIAKLWAVkd 400
gi 262396596 321 PKIAGMLEEITGLRFKAKKAAAFGSYGWNGGAVDRIHARLTDAGFETAVSLKTKWRPDGKAMRECREHGKSIAKLWAK-- 398
gi 209695636 321 PKIAGMLEEITGLRFRAKKAGAFGSYGWNGGAVDRIHSRLTDAGFETAVGLKAKWRPDGKAMQLCREHGQFIAKQWAL-- 398
gi 59712389  321 PKIAGMLEEIAGLRFRAKKAGAFGSYGWNGGAVDRIHSRLTDAGFETAVGLKAKWRPDGQAMKLCREHGQFIAKQWAL-- 398
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 145301103 399 ------------------HPleapcpIITTSAAAAPVVeagvvvemsvpasagvve----vgvpafsgamelpvsrgV-A 455
gi 157377185 399 ------------------HPleniesKQASPVNEPLLNtaease----------------------------pavnaQvS 432
gi 212633941 399 ------------------QPltavasLAEAKLSTEPNP-----------------------------------------A 419
gi 54308337  399 ------------------QP------LTVATTRAVINElnvaprsvvasqsvvtpqpvvetvtpatneaavvqqevtS-T 453
gi 218677179 401 devstpkqvsrnvtpleaTP------APANTTAELKDTte------------------------------------qKpE 438
gi 37675841  401 kstlst----pvnafqsaTP------IEGIEAQQPLTE-----------------------------------------T 429
gi 27367713  401 kstlst----pvnafqsaTP------IEGIEAQQPLTE-----------------------------------------T 429
gi 262396596 399 ------------------HPltspvaAPMMAASAPQVQ-----------------------------------------S 419
gi 209695636 399 ------------------KP------VTTTFQTINVEKktipasiaep-------------------vimvdpsvssTvE 435
gi 59712389  399 ------------------AP------LTTTFNTINVDKkiqtieepv---------------------vlvepsaelE-K 432
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 145301103 456 PTT---CEQDDDQP----------------MLCTVCQWIYDPALGEPDQLVAPGTPWARVPDSFLCPGCGIGKEVFEPCA 516
gi 157377185 433 STC---VETTAGQS----------------MLCSVCQWVYDPALGEPNQDVAPGTEWTDVPETFLCPDCSLGKGVFDPIA 493
gi 212633941 420 AQTakpVSASAEEQalaehs-----adcqcMICTVCNWVYDPAKGEPNQEIEPGTTWADIPEYFLCPECNLGKDVFVEHN 494
gi 54308337  454 TTA---SSTDQKQK----------------QICTVCQWIYNPELGEPNQGVEPKTAWEEVPDSFLCPECGIGKQVFEPTN 514
gi 218677179 439 EAQdkpVHSADCTC----------------WRCTVCEWVYDPQLGEPYQGVEPGTPWAQVPDDFLCPECHLGKEVFVEK- 501
gi 37675841  430 TPTadaAHSADCQC----------------MVCTVCNWVYDPAKGEPNQGIEVGTTWADVPDYFLCPECHLGKDVFVEYQ 493
gi 27367713  430 TPTadaAHSADCQC----------------MVCTVCNWVYDPAKGEPNQGIEVGTTWADVPDYFLCPECHLGKDVFVEYQ 493
gi 262396596 420 QPVvqvETQAVVERelinpsseahpsdcqcMICTVCNWVYDPAQGEPNQGIKPGTTWSDVPDYFLCPECHLGKDVFVEFK 499
gi 209695636 436 SEIsviASNDDKQC----------------MLCTVCNWVYDPEIGEPNQGVEPNTAWIDVPDYFLCPECNLGKDVFVEVK 499
gi 59712389  433 PATevtSSKDAKQC----------------MLCSVCNWVYDPEIGEPNQGVEPNTPWSSVPNDFLCPECHLGKDVFVEIK 496

                 ....
gi 145301103 517 VEAC 520
gi 157377185 494 KEAA 497
gi 212633941 495 A--- 495
gi 54308337      ----
gi 218677179     ----
gi 37675841  494 G--- 494
gi 27367713  494 G--- 494
gi 262396596 500 G--- 500
gi 209695636     ----
gi 59712389      ----
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap