Conserved Protein Domain Family
PRK05433

?
PRK05433: PRK05433 
GTP-binding protein LepA; Provisional
Statistics
?
PSSM-Id: 235462
View PSSM: PRK05433
Aligned: 1006 rows
Threshold Bit Score: 873.975
Threshold Setting Gi: 296111315
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 284030330  13 RTDPTLIRNFCIIAHIDHGKSTLADRMLQITGVVDDRSMRAQYLDRMDIERERGITIKSQAVRLPFAP-Kpdtpggllap 91
gi 15604145    1 MNNQKYIRNFSIIAHIDHGKSTLADRLIEYCGGLNAREMSQQVLDSMDIERERGITIKAQTVRLVYKAkN---------- 70
gi 51473472    1 MNNQKYIRNFSIIAHIDHGKSTLADRLIEHCGGLNAREMSQQVLDSMDIEKERGITIKAQTVRLVYKAkN---------- 70
gi 157825494   1 MKNQKYIRNFSIIAHIDHGKSTLADRLIEHCGGLQAREMRTQVLDSMDIEKERGITIKAQTVRLVYKAkD---------- 70
gi 157803497   1 MNNQKYIRNFSIIAHIDHGKSTLADRLIEHCGGFQAREMSKQVLDSMDIEKERGITIKAQTVKLLYKAkD---------- 70
gi 157827016   1 MNNQKYIRNFSIIAHIDHGKSTLADRLIEYCGGLQAREMSQQVLDSMDIEKERGITIKAQTVRLVYKAkD---------- 70
gi 67459392    1 MNNQKYIRNFSIIAHIDHGKSTLADRLIEHCGGLQAREMSQQVLDSMDIEKERGITIKAQTVRLVYKAkD---------- 70
gi 148284680   1 MQQQSNIRNFAIIAHIDHGKSTLADRLIEYCNALEAREMCQQVLDSMDIEKERGITIKAQTVRLVYKAdD---------- 70
gi 189183641   1 MQQQSNIRNFAIIAHIDHGKSTLADRLIEYCNALEAREMCQQVLDSMDIEKERGITIKAQTVRLVYKAdD---------- 70
gi 71083150    1 MTKIDHIRNFAIIAHIDHGKSTIADRIIHSCGGLTEREMKAQVLDSMDIERERGITIKAQTVKLNYKAkD---------- 70
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 284030330  92 eGTTYILNMIDTPGHVDFTYEVSRSLEACEGAVLLVDAAQGIEAQTLANLYLALNADLHIIPVLNKIDLPGAMPEKYAAE 171
gi 15604145   71 -GNTYYLNLMDTPGHVDFAYEVSRSLAACEGSLLVVDSTQGVEAQTLANVYQAIANDHLIVPVLNKIDLAASEPDYVKTQ 149
gi 51473472   71 -GNTYYLNLMDTPGHVDFSYEVSRSLAACEGSLLVVDSTQGVEAQTLANVYQAIANDHEIVPVLNKIDLAASEPEHVKKQ 149
gi 157825494  71 -GNTYYLNLMDTPGHVDFAYEVSRSLAACEGSLLVVDSTQGVEAQTLANVYQAIEHDHEIVPVLNKIDLPASEPEQVKQQ 149
gi 157803497  71 -GNTYYLNLMDTPGHVDFAYEVSRSLAACEGSLLVVDSTQGVEAQTLANVYKAIENNHEIVPVLNKIDLPASEPEHVKQQ 149
gi 157827016  71 -GNTYYLNLMDTPGHVDFAYEVSRSLAACEGSLLVVDSTQGVEAQTLANVYQAIENDHEIVPVLNKIDLPASEPDQVKQQ 149
gi 67459392   71 -GNTYYLNLMDTPGHVDFAYEVSRSLAACEGSLLVVDSTQGVEAQTLANVYQAIENDHEIVPVLNKIDLPASEPEQVKQQ 149
gi 148284680  71 -GCVYHLNLMDTPGHVDFAYEVSRSLAACESSLLVVDASQGVEAQTLANLYQAVDNNHKILIVLNKIDLPAANPQQVQQQ 149
gi 189183641  71 -GCVYHLNLMDTPGHVDFAYEVSRSLAACESSLLVVDASQGVEAQTLANLYQAVDNNHKILIVLNKIDLPAANPQQVQQQ 149
gi 71083150   71 -GKDYILNIIDTPGHVDFSYEVSRSLYACEGSILIVDSTQGVEAQTLANVYQALDTKHEIVPVLNKVDLPASDLEKTKKQ 149
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 284030330 172 LAHIIGCKESDVLRVSAKTGEGVEDLLSEIVAQVEPPKGVKDAPPRALIFDSVYDTYRGVVTYVRVVDGELTHRDKIKMM 251
gi 15604145  150 IEDIIGIDASEAVLISAKNGIGIDSVLEAIINKLPAPKESSTDILKALLVDSWYDPYLGVVILVRIIDGALRKNMRVKMM 229
gi 51473472  150 IEDIIGIDASEAVLISAKNGIGIDSVLEAIINKLPSPKESSTDTLKALLVDSWYDPYLGVVILVRIIDGTLRKNMRVKMI 229
gi 157825494 150 IEDIIGIDASEAVLISAKSGIGIDLVLEAIVNKLHPPKESSTDILKALLVDSWYDPYLGVVILVRIIDGTLRKNMRIKMM 229
gi 157803497 150 IEDIIGIDASEALLISAKSGIGIDLVLEAIVNKLPPPKESSDDILKALLVDSWYDPYLGVVILVRIIDGALRKNMRIKMM 229
gi 157827016 150 IEDIIGIDASEAVLISAKSGIGIDLVLEAIVNKLPPPKESSTDILKALLVDSWYDPYLGVVILVRVIDGSLRKNMKVKMM 229
gi 67459392  150 IKDIIGIDASEAVLISAKSGIGIDLVLEAIVNKLPPPKESSSDILKALLVDSWYDPYLGVVILVRIIDGTLRKNIRIKMM 229
gi 148284680 150 IEDVIGIDASDALMISAKIGLGIKDVLQAIVTKLPSPNGDSQSQLKALLIDSWYDSYLGVVILVRVVDGKIEKGMRIRMC 229
gi 189183641 150 IEDVIGIDASDALMISAKIGLGIKDVLQAIVTKLPSPNGDSQSQLKALLIDSWYDSYLGVVILVRVVDGKIEKGMRIRMC 229
gi 71083150  150 IEEVIGIDTENAIPCSGKTGEGIEDILEQIIVSLPAPEGEKDADLKCLLVDSWYDTYLGVVILVRVINGKISKNMKIKMM 229
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 284030330 252 STGAVHEMLEVGVISPEPMKSPSIGVGEVGYLITGVKDVRQSRVGDTVTSSIRGASEALGGYKHPQPMVYSGLFPIDGDD 331
gi 15604145  230 RTNSVYTVEHVGFFTPKKHISDVLYAGEIGFFTASIKRVSDCKVGDTITDEKKSCEQALPGFKPNIPVVFCGFYPTDSAE 309
gi 51473472  230 GTNSVYTVEHVGFFTPKKHISDVLYAGEIGFFTASIKRVSDCKVGDTITDEKKSCEQALPGFKPNIPVVFCGFYPTDSAE 309
gi 157825494 230 ATNSVYTVENVGFFTPKKHISDVLYAGEIGFVTASIKQVADCKVGDTITDEKKPCEQALPGFKPNLPVVFCGLYPTDSSE 309
gi 157803497 230 ATNSVYKVEHVGYFTPKKHIADVLYAGEIGFFTASIKQVADCKVGDTITDEKKPCEQALPGFKPNLPVVFCGFYPTDSSE 309
gi 157827016 230 ATNSVYTIENVGYFTPKKHISDVLHAGEIGFFTASIKQVADCKVGDTITDEKKPCKQALPGFKPNLPVVFCGLYPTDSSE 309
gi 67459392  230 ATNSVYTVENVGYFTPKKHISDVLHAGEIGFFTASIKQVADCKVGDTITDEKKPCEQALPGFKPNLPVVFCGLYPTDSAE 309
gi 148284680 230 SNNAVYTVENVGFFSPKKQISGVLYTGEIGFVTAAIKQVADCRVGDTITDDKKPCAQILPGFKPNLPVVFCGLYPSDASQ 309
gi 189183641 230 SNNAVYTVENVGFFSPKKQISGVLYTGEIGFVTAAIKQVADCRVGDTITDDKKPCAQILPGFKPNLPVVFCGLYPSDASQ 309
gi 71083150  230 STDQEYIIEKVGVFTPKATDVNELNAGEIGFITTGIKILSETKVGDTICDATKPPQEALPGFKPSKPVVFCGLFPVDSSE 309
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 284030330 332 YPTLRDALERLQLNDAALQYEPESSGALGFGFRCGFLGLLHMEIVRERLEREFDLDLISTAPNVVYRVEMEDGKEHVVTN 411
gi 15604145  310 FEHLKDSLAKLRLNDASFEYEMESSSALGVGFRCGFLGLLHLEIIQERLSREFDLDLITTAPSVIYKINMLDGQNLEIHN 389
gi 51473472  310 FEHLKDSLAKLRLNDASFEYEMESSSALGVGFRCGFLGLLHLEIIQERLSREFNLDLITTAPSVIYKIYMLDGESLEIHN 389
gi 157825494 310 FEHLKDSLAKLRLNDASFEYEMESSSALGVGFRCGFLGLLHLEIIQERLSREFDLDLITTAPSVVYKIHMRYGESLEIHN 389
gi 157803497 310 FEYLKDSLAKLHLNDSSFEYEMESSSALGVGFRCGFLGLLHLEIIQERLSREFDLDLITTAPSVIYKIYMRDGESLEIYN 389
gi 157827016 310 FEHLKDSLAKLRLNDASFEYEMESSSALGVGFRCGFLGLLHLEIIQERLSREFDLDLITTAPSVVYKIHMREGEVLEIHN 389
gi 67459392  310 FEHLKDSLAKLRLNDASFEYEMESSSALGVGFRCGFLGLLHLEIIQERLSREFDLDLITTAPSVVYKIHMRDGESLEIHN 389
gi 148284680 310 FNHLKDSLQKLRLNDASFEFEQESSGALGFGFRCGFLGLLHLEIIQERLEREFDLDMITTAPSVMYKVYLNTGKVIDVHN 389
gi 189183641 310 FNHLKDSLQKLRLNDASFEFEQESSGALGFGFRCGFLGLLHLEIIQERLEREFDLDMITTAPSVMYKVYLNTGKVIDVHN 389
gi 71083150  310 YQKLKDGLGKLQLNDASFSYEAESSSALGLGFRCGFLGLLHLEIITERLEREFDINLLTTTPGVVYKVHMNKGDIIELQN 389
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 284030330 412 PSEFP-DGKIADIYEPVVRATILSPKDFIGVIMDLCQTKRGNLQGMEYLSEdRVELRYTLPLAEIVFDFFDQLKSKTKGY 490
gi 15604145  390 PADLPdLQKIASMEEPWIKATIIVPDEFIGTVLSLCTEKRGIQLDHSYISN-RAKIVYKLPLNEIVYDFYDRLKSCSKGY 468
gi 51473472  390 PADLPdLQKIASMEEPWIKATIMVPDEFIGTVLSLCKEKRGIQLDHSYISN-RAKIVYKLPLNEIVYDFYDRLKSCSKGY 468
gi 157825494 390 PADLPdLQKIESMEEPWIKATIMVPDEFLGAVLSLCTEKRGVQLDHSYIAN-RAKIVYKLPLNEIVYDFYDRLKSCSKGY 468
gi 157803497 390 PADLPnLQKIESIEEPWIKAIIIVPDEFLGAVLSLCTEKRGVQLDHSYIAN-RARIVYKLPLNEIVYDFYDRLKSCSKGY 468
gi 157827016 390 PADLPdLQKIDSMEEPWIKATIMVPDEFLGAVLSLCTEKRGIQLDHNYIAN-RAKVVYKLPLNEIVYDFYDRLKSCSKGY 468
gi 67459392  390 PADLSdLQKIESMEEPWIKATIMVPDEFLGAVLSLCTEKRGVQLDHSYIAN-RAKIIYKLPLNEIVYDFYDRLKSCSKGY 468
gi 148284680 390 PADLPeMQKIKSMSEPWVEATIFIPDQYLGAILGLCTEKRGVQVDLTYVNG-RAKLVYLLPLNEIVFDFYDKLKSYSKGY 468
gi 189183641 390 PADLPeMQKIKSMSEPWVEATIFIPDQYLGAILGLCTEKRGVQVDLTYVNG-RAKLVYLLPLNEIVFDFYDKLKSYSKGY 468
gi 71083150  390 PSSLPePTLIKFIEEPWIKATIITPDQYLGAIIKVCQDKRGVQTNLSYSGN-RAVLNYEIPLNEVVFDFNDRLKSMTSGY 468
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 284030330 491 ASLDYEPTGEQAAALVKVDILLQGETVDAFSAIVHRDNAYAYGVALAGKLKELIPRQQFEVPIQAAIGSRIIARESIRAI 570
gi 15604145  469 ASFEWQMDVYELSDLVNLRILVNGEVVDALSTIVHRSRAEQRGRALCIRLKDLIPRQQIDIAIQASVGSRIIARETIKAL 548
gi 51473472  469 ASFEWQMDVYELSDLVNLRILVNGEVVDALSTIVHRSRAEQRGRALCVRLKDLIPRQQIDIAIQASVGNRIIARETIKAL 548
gi 157825494 469 ASFEWQIDVYEPSELVKLGILVNGEVIDALSTIVHRSRAEQRGKVLCVRLKDLIPRQQIDIAIQASIGSRIIARETIKAL 548
gi 157803497 469 ASFEWQMDVYAPSELVKLGILVNGKAVDALSTIVHRSRAEQTGRALCVRLKDLIPIQQIDIVIQASIGSRIIARETIKAL 548
gi 157827016 469 ASFEWQMDTYEPSELVKLGILVNSEVVDALSTIVHRSRAEQRGRALCVRLKDLIPRQQIDIAIQASIGSRIIARETIKAL 548
gi 67459392  469 ASFEWQMDVYEPSELVKLGILVNGEEVDALSTIVHRSRAEQRGRALCVRLKDLIPRQQIDIAIQASIGSRIIARETIKAL 548
gi 148284680 469 ASFDWQIDSYKQSDLIKLSILVNGNPVDALSTIVHRSKAEFRGRELCKRLKDLIPAHLFQIAIQAAIGSRIIARETIRAL 548
gi 189183641 469 ASFDWQMNSYKQSDLIKLSILVNGNPVDALSTIVHRSKAEFRGRELCKRLKDLIPAHLFQIAIQAAIGSRIIARETIRAL 548
gi 71083150  469 ASFDYEIIGHREGDLVKLGILVNAEPVDALSMMVHKDFAQTVGREVCEKLKDLIPRHNFMIPVQAAIGGKIIARETIKGF 548
                        570       580       590       600       610
                 ....*....|....*....|....*....|....*....|....*....|..
gi 284030330 571 RKDVLAKCYGGDI-TRKRKLLEKQKEGKKRMKMVGRVEVPQEAFIAALKTNE 621
gi 15604145  549 RKDVLSKCYGGDI-SRKRKLLEKQKAGKKKMRQYGNIEIPQSAFIAALQIGG 599
gi 51473472  549 RKDVLSKCYGGDI-SRKRKLLEKQKAGKKKMRQYGNIEIPQSAFIAALQIGG 599
gi 157825494 549 RKDVLSKCYGGDI-SRKRKLLEKQKAGKKRMRQYGNIEIPQSAFIAALKIGD 599
gi 157803497 549 RKDVLSKCYGGDI-TRKRKLLEKQKIGKKRMRQYGNIEIPQSAFIAALKIGD 599
gi 157827016 549 RKDVLSKCYGGDI-TRKRKLLEKQKAGKKRMRQYGNIEIPQSAFIAALKIGD 599
gi 67459392  549 RKDVLSKCYGGDI-SRKRKLLEKQKAGKKRMRQYGNIEIPQSAFIAALKIGD 599
gi 148284680 549 RKDVLAKCYGGDI-TRKRKLLEKQKAGKKRMRNIGNVEIPQSAFIAALKITN 599
gi 189183641 549 RKDVLAKCYGGDI-TRKRKLLEKQKAGKKRMRNIGNVEIPQSAFIAALKITN 599
gi 71083150  549 KKDVLTKIHGGGArDRKRKLLDKQKKGKARGKQFGKVEIPQEAFIGVLKINK 600
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap