Conserved Protein Domain Family
tdh

?
PRK05396: tdh 
L-threonine 3-dehydrogenase; Validated
Statistics
?
PSSM-Id: 180054
View PSSM: PRK05396
Aligned: 262 rows
Threshold Bit Score: 530.553
Threshold Setting Gi: 55980538
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 167626434   1 MKALAKLKKEPGIWMIdDAPMPEYGYNDVLIKIKKTAICGTDLHIYNWDKWSQATIPVPMITGHEFAGEVVAKGNGVTSV 80
gi 14521586    5 MVAIMKTKPAYGAELV-EVDVPKPGPGEVLIKVIATSICGTDLHIYEWNEWAQSRIKPPQIMGHEVAGEVVEVGPGVEGI 83
gi 14590542    5 MVAIMKTKPGYGAELV-EVDVPKPGPGEVLIKVLATSICGTDLHIYEWNEWAQSRIKPPQIMGHEVAGEVVEIGPGVEGI 83
gi 18977363    5 MVAIMKTKPEYGAELV-EVDVPKPGPGEVLIKILATSICGTDLHIYEWNEWAQTRIRPPQIMGHEVAGEVVEVGPGVEGI 83
gi 51893011    5 MRALRKLEAGPGATLQ-EVPIPTIGPRDVLVKVRAASICGTDYHIYTWDPWSAGRVKPPLTIGHELAGEVVAVGREVTAC 83
gi 167039435   6 MTAVVKQHTTEGADII-KKEIPIIGPDEVLIKVKATSICGTDVHIYVWNEWAKSRIKPPKTMGHEFVGEVVEIGKNVTSV 84
gi 167036715   6 MTAVVKQHTTEGADII-KKEIPIIGPDEVLIKVKATSICGTDVHIYVWNEWAKSRIKPPKTMGHEFVGEVVEIGKNVTSV 84
gi 212223543   5 MPAIVKTKPAYGAELV-EVDIPKPGPGEVLIKVLATSICGTDLHIYEWNEWAQSRIKPPQIMGHEVAGEVIEVGPGVDTI 83
gi 240103205   5 MPAIMKTKPAYGAELV-EVDVPKPGPGEVLIRVLATSICGTDLHIYEWNEWAQSRIKPPQIMGHEVAGEVVEVGPGVEDL 83
gi 57640851    5 MQAIMKTKPAYGAELV-EVDVPKPGPGEVLIKVLATSICGTDLHIYEWNEWAQSRIKPPQIMGHEVAGEVVEVGPGVEDL 83
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 167626434  81 DVGDRVSGEGHLVCGQCRNCRAGKRHLCRKTIGIGVNVQGAFAEYLVMPAVNVFKIPDSISDDIASTFDPMGNAIHTALS 160
gi 14521586   84 EVGDYVSVETHIVCGKCYACRRGQYHVCQNTKIFGVDTDGVFAEYAVVPAQNVWKNPKSIPPEYATLQEPLGNAVDTVLA 163
gi 14590542   84 EVGDYVSVETHIVCGKCYACRRGQYHVCQNTKIFGVDTDGVFAEYAVVPAQNIWKNPKSIPPEYATLQEPLGNAVDTVLA 163
gi 18977363   84 EVGDYVSVETHIVCGKCYACKRGQYHVCQNTKIFGVDTDGVFAEYAVVPAQNVWKNPKNIPPEYATLQEPLGNAVDTVLA 163
gi 51893011   84 KVGDYVSAETHIVCNRCPRCHMGEYHLCENTKILGVDTDGAFAEYVAVPEQNIWVNDKDIPFELQSIQEPLGNAVHTALN 163
gi 167039435  85 KVGDLVSAETHIVCGKCKACRTGNAHICENTLILGVDTDGAFAEYIKVPESNVWLNDKDIPLELLSIQEPLGNAVHTVFS 164
gi 167036715  85 KVGDLVSAETHIVCGKCKACRTGNAHICENTLILGVDTDGAFAEYIKVPESNVWLNDKDIPLELLSIQEPLGNAVHTVFS 164
gi 212223543  84 NVGDYISAETHIVCGKCYACKHNRYHVCQNTKIFGVDMDGVFAEYAIVPAQNAWKNPKDMPPEYATLQEPLGNAVDTVLA 163
gi 240103205  84 QEGDYISVETHLVCGKCYACKHNRYHVCQNTKIFGVDMDGVFATYAIVPAKNAWKNPKDMKPEYAALQEPLGNAVDTVLA 163
gi 57640851   84 QVGDYISVETHIVCGKCYACKHNRYHVCQNTKIFGVDMDGVFAHYAIVPAKNAWKNPKDMPPEYAALQEPLGNAVDTVLA 163
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 167626434 161 FNLTGEDVLITGAGPIGLMAVKIARFCGARRIVITDINKYRLQMARDFGATVAVNVSEfqnqqqltAQMRKVMSEIGMTE 240
gi 14521586  164 GPISGKSVLITGAGPLGLLGIAVAKASGAYPVIVSEPSDFRRELAKKVGADYVINPFE--------EDVVKEVMDITDGN 235
gi 14590542  164 GPISGKSVLITGAGPLGLLGIAVAKASGAYPVIVSEPSDFRRELAKKVGADYVINPFE--------EDVVKEVMDITDGN 235
gi 18977363  164 GPIAGKSVLITGAGPLGLLGIAVAKASGAYPVIVSEPSEFRRNLAKKVGADYVINPFE--------EDVVKEVMDITDGN 235
gi 51893011  164 GDLTARSVLITGCGPIGIMSVPVAKMAGAEIVMAMDINEYRLQLAGQLGADVLINPTK--------QDPVEVVRSYTRGY 235
gi 167039435 165 GEVVGKTVAVVGCGPIGMMAIPLLKTTGASAVFAIEPVEYRRELAHKLGATRVINPLK--------EDVVSIIKSETEGY 236
gi 167036715 165 GEVVGKTVAVVGCGPIGMMAIPLLKTTGASAVFAIEPVEYRRELAHKLGATRVINPLK--------EDVVSIIKSETEGY 236
gi 212223543 164 GPIAGRSTLITGAGPLGLLGIAVAKASGAYPVIVSEPSEFRRELAKKVGADYVVNPFE--------EDPVKFVMDITDGA 235
gi 240103205 164 GPIAGRSTLITGAGPLGLLGIAVAKASGAYPVIVSEPSDFRRKLAKKVGADYVVNPFE--------EDPVEVVMSITDGA 235
gi 57640851  164 GPIAGRSTLITGAGPLGLLGIAVAKASGAYPVIVSEPSEFRRKLAKKVGADYVVNPFE--------EDPVKFVMDITDGA 235
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 167626434 241 GFDVGLEMSGINSAISMMLDVMNHGGKLSLLGISAGDISVDW-GAILFKGLTLKGIYGREMFETWYLMTSMLQAG-MD-M 317
gi 14521586  236 GVDVFLEFSGAPKALEQGLQAVTPAGRVSLLGLYPGKVSIDFnNLIIFKALTVYGITGRHLWETWYTVSRLLQSGkLN-L 314
gi 14590542  236 GVDVFLEFSGAPKALEQGLQAVTPAGRVSLLGLYPGKVTIDFnNLIIFKALTIYGITGRHLWETWYTVSRLLQSGkLN-L 314
gi 18977363  236 GVDVFLEFSGAPKALEQGLQAVTPAGRVSLLGLFPGKVSIDFnNLIIFKALTVYGITGRHLWETWYTVSRLLQSGkLN-I 314
gi 51893011  236 GADVVLEMSGNPTAIRQGLKAARNGARISLLGLPGRPLELDLaADVIMRGLVLQGITGRRMWQTWYQVRSLYRAGlAErL 315
gi 167039435 237 GADVVLDFSGSSIAIRQGLKYIAKGGRMSILGLPDNEVPIDItNDVIFKGITIHGITGRRMYDTWYQVKGLLRSGlKDaL 316
gi 167036715 237 GADVVLDFSGSSIAIRQGLKYIAKGGRMSILGLPDNEVPIDItNDVIFKGITIHGITGRRMYDTWYQVKGLLRSGlKDaL 316
gi 212223543 236 GVEVFLEFSGAPKAFEQGLQAVTPGGRVSLLGLFPREVTFDInNLVIFKALEVHGITGRHLWETWYTVSSLIQSGkLN-L 314
gi 240103205 236 GVEVFLEFSGAPKALEQGLKATTPGGRVSLLGLFPRDVTLDFnNLIIFKALEIHGITGRHLWETWYTVSSLIQSGkLN-L 314
gi 57640851  236 GVEVFLEFSGAPKALEQGLKAVTPGGRVSLLGLFPREVTIDFnNLIIFKALEVHGITGRHLWETWYTVSSLIQSGkLN-L 314
                        330       340       350
                 ....*....|....*....|....*....|....
gi 167626434 318 EPIITHRLH-IDDYQKGFEIMKSGQCGKVILDWS 350
gi 14521586  315 DPIITHKYKgFDKYEEAFELMRAGKTGKVVFMLK 348
gi 14590542  315 DPIITHKYKgFDKYEEAFELMRAGKTGKVVFMLK 348
gi 18977363  315 DPIITHKYKgFDKYEEAFELMRAGKTGKVVFMLK 348
gi 51893011  316 RPLVTHRMP-LEQIDAAMELMGSGQSGKIVLVPD 348
gi 167039435 317 KPIITHTFP-LTEYQKGMELMIKGQCGKVVL-YP 348
gi 167036715 317 KPIITHTFP-LTEYQKGMELMIKGQCGKVVL-YP 348
gi 212223543 315 DPIITHKYKgFDKFEEAFELMRAGKTGKVVFFPH 348
gi 240103205 315 DPIITHRYKgFDKYEEAFELMRAGKTGKVVFFPK 348
gi 57640851  315 DPIITHKYKgFDKFEEAFELMRAGKTGKVVFFPH 348
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap