Conserved Protein Domain Family
PRK05379

?
PRK05379: PRK05379 
bifunctional nicotinamide mononucleotide adenylyltransferase/ADP-ribose pyrophosphatase; Provisional
Links
?
Statistics
?
PSSM-Id: 235436
View PSSM: PRK05379
Aligned: 47 rows
Threshold Bit Score: 358.554
Threshold Setting Gi: 94985425
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161897892   4 FEYDFLVFIGRFQPFHRGHLAVIEQGLRKARQMIVLCGSAHQPRSTRNPWSVSEREDMVRSALs--KADNQRVHIAPLMD 81
gi 156501846   1 -MYDISVFIGRFQPFHKGHLHNIIIALQNSKKVIINIGSCFNAPNIKNPFSFEQRKQMIESDLqvaGIDLDTVVIEPLAD 79
gi 187931340   1 -MYDISVFIGRFQPFHKGHLHNIIIALQNSKKVIINIGSCFNAPNIKNPFSFEQRKQMIESDLqvaGIDLDTVVIEPLAD 79
gi 118497083   1 -MYDISVFIGRFQPFHKGHLHNIIIALQNSKKVIINIGSCFNAPNIKNPFSFEQRKQMIESDLqvaGINLDTVVIEPLAD 79
gi 167626585   1 -MYDISVFIGRFQPFHKGHLHNIQVALKHSKRIIINVGSSFNAPNIKNPFSFEFRKQMIIEDLklaGIDLCLIEIEPLAD 79
gi 15807415   17 PSRAYGVYIGRFEPPHQAHLLVMLEALERVQTLIVVIGSARSARTTKNPWTAHERQDVIEAMLaeaGADPQRLRFVHVRD 96
gi 15807935    5 STLSGAVYVGRFQPPHAAHVASVLAALEAAPRVLVLLGSANLARSVKNPFTPAEREVMFRAALtdaGADLRRVTFRPLPD 84
gi 94984336   17 RKRTFGVYIGRFEPPHQAHLLVMLEALQWVQKLIVVIGSARAARNTKNPFTAEERQEMITAMLreaGVAKSRLLFVQVRD 96
gi 94985425    4 PPAPAAVFVGRFQPPHAAHVATVQHALVHASRVLVLLGSANLARSIRNPFSAPERAAMFGAALretGVRRGRVLFRPLPD 83
gi 226357023  11 RKRTFGVYIGRFEPPHQAHLLVMLEALQSVQKLIVVVGSARAARNTKNPFTAEERQDLITAMLleaGVPRSRVLFVHVRD 90
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161897892  82 IVYNDEIWVRNVQSTVQGLVtahhgmpHKSAKVGLIGHSKDHSSFYLKLFPQWGSVEVENVDGISATPVREAIFGVNQTD 161
gi 156501846  80 YFYQEQKWQDELRKNVYKHA-------KNNNSIAIVGHIKDSSSYYIRSFPEWDYIGVDNYKNFNATEFRQKFYNGIISK 152
gi 187931340  80 YFYQEQKWQDELRKNVYKHA-------KNNNSIAIVGHIKDSSSYYIRSFPEWDYIGVDNYKNFNATEFRQKFYNGIISK 152
gi 118497083  80 YFYQEQKWQDELRKNVYKHA-------KNNNSIAIVGHIKDSSSYYIKSFPEWDYIGVDNYKNFNATEFRQKFYNGIISK 152
gi 167626585  80 YFYQEQKWEESLRQNVYKHA-------KSDETIAIVGHIKDDSSYYIKSFPEWGYIPVDNYKNYNATEFRKYFYKGKILG 152
gi 15807415   97 FLYDEAHWLADVRAGVEAHT-------GGSRDVALVGHIKDESSYYLRSFPDWEFLPTHVVSPLNATDVRRAYFEDRLSD 169
gi 15807935   85 R-FDADLWAADVRAVAAEIF-------GPGASVGLVGFEKDASSSYLRWFPGWQRVNVPETPGLNATDIRTALFEGAPLP 156
gi 94984336   97 SFYNEGLWLSEVQRGVAEHT-------RGSSDVALIGHFKDESSYYLRSFPAWEFLPTHVVSPLNATDVRKALFEDRLDE 169
gi 94985425   84 R-FNAELWAADVRAAAAEVF-------GPETPVQLVGFEKDASTAYLRWFPAWERLPAPELPGLNATDLRAAWLTGRPLP 155
gi 226357023  91 YFYNESLWLSEVQAGVQAHT-------RGSTDVALIGHLKDESSYYLRSFPAWEFIPTHVVSALSATDVRRAYFEDRVED 163
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161897892 162 RRGGmhylessdadlALPAAVREKLAKFCLSEDYEEIKYEHDFIAKYKRAWSAAPYAPTFVTVDA--VVVQSGHVLLVER 239
gi 156501846 153 QYMCs---------nDPKLGTYNFLTKFMDTQVYQDLVAENNYVIEYKRLWLKAPFKPNFVTVDA--LVIVNDHILMVQR 221
gi 187931340 153 QYMCs---------nDPKLGTYNFLTKFMDTQVYQDLVAENNYVIEYKRLWLKAPFKPNFVTVDA--LVIVNDHILMVQR 221
gi 118497083 153 QYMCs---------nDPKLGTYNFLTKFMDTQAYQDLVAENNYVIEYKRLWQKAPFKPNFVTVDA--LVIVNDHILMVQR 221
gi 167626585 153 EYMCs---------pAPNQGTFKLLNTFMQSVTYQDLVAENSYVIDYKYSWRNAPYKPNLVTVDA--LVIVNNYILLVQR 221
gi 15807415  170 VRG------------MVPPAVHAFLEGFQRTPEYAELQAEFLALRS-----AVAPAPATRLTVGA--VVSGAGQLLAVRR 230
gi 15807935  157 A--------------GLPRPVSGALGRFAHTPTCARLRREWTAVGQER-----AALPPGTVLQEErwLHVMDRRVWLAHR 217
gi 94984336  170 VRS------------MVPPTVHAFLSAFRQTPAYAELRSEYDDLRESRAAWLGAPFPPVFVTADA--VVTRSGHVLVVRR 235
gi 94985425  156 E--------------GVPPPVRAFLARFAVTPAFIRLQAEWAAVEAAR-----AVLPPGVHLHEErwLHVAQGQVWLHTR 216
gi 226357023 164 VPG------------MVPPAVHAFLVQFRQTSEYAELRAEYDYLRDYRAAWKDAPFPPVFVTTDA--VVTRSGHVLLVRR 229
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 161897892 240 KARPGKGLLALPGGFVDQNEKLLDACLRELREETRLKVPAPVLRGSIKAQQVFDDPHRSARGRTITHAFHIELEPSSe-L 318
gi 156501846 222 KAHPGKDLWALPGGFLECDETIAQAIIRELFEETNINLTHEQLAIAKRCEKVFDYPDRSVRGRTISHVGLFVFDQWPs-L 300
gi 187931340 222 KAHPGKDLWALPGGFLECDETIAQAIIRELFEETNINLTHEQLAIAKRCEKVFDYPDRSVRGRTISHVGLFVFDQWPs-L 300
gi 118497083 222 KAYPGKDLWALPGGFLECDETIAQAIIRELFEETNINLTHEQLAIAKRCEKVFDYPDRSVRGRTISHVGLFVFDQWPs-L 300
gi 167626585 222 KGFPGKGLWALPGGFLECDETISQAIIRELFEETNIDLSIEQLSLAKRCEKVFDYPGRSVRGRTISHVGVFIFEEWPd-L 300
gi 15807415  231 AERPGRGLLTLPGDEPGPQETLLACAMRAVRQQTGLD--TGAVLGAVRAQAIFDAPGRSQRGRIVAYVFHFALG-----E 303
gi 15807935  218 PGPIGQGLWELPGRVLPPGEVLPPGEV------------LPPGEVPLPGDATFDHPARTLVTRT---------------V 270
gi 94984336  236 AGFPGRGRLAMPGGFLRPDETLLACAVRQVHSETGLNAAVN-LTERVRSQAVFDYPGRSQRGRTVTHAFHFDLGLGQ--L 312
gi 94985425  217 QDDIGRGLWELPGRVLPPGE-----------------------LPATPADALFDHPARALVAPTAAHVWLGPPPASFvaR 273
gi 226357023 230 GGMPGRGRLAMPGGFLEQKETLLECCVRNVHEETGVG-EGTHLSAALKSQAVFDYPDRSQRGRTVTHAFYFDLGIGQ--L 306
                        330       340       350       360
                 ....*....|....*....|....*....|....*....|...
gi 161897892 319 PKVKGGDDARQAMWVPL-AELDP--GKLY-EDHYFIIQEMTGI 357
gi 156501846 301 PEINAADDAKDVKWISLgSNIKNicDRML-EDHYQIITILLEE 342
gi 187931340 301 PEINAADDANDVKWISLgSNIKNicDRML-EDHYQIITILLEE 342
gi 118497083 301 PEINAADDAKDVKWISLdSNIKNicDRML-EDHYQIITILLEE 342
gi 167626585 301 PSIYAADDARDVKWLNFdLINRKiyDSML-EDHYQIINFLLEE 342
gi 15807415  304 DALTAQPAGNAAAWLPL-SEALEhpEGWF-EDEAEIVAHFLAK 344
gi 15807935  271 AQIRLGAPPAGFQVVPVcLEVALsrPRLFhEDHSVILARLTGH 313
gi 94984336  313 PVLQAAAGAAEAFWMPF-SEALAepELFF-EDHHAIIESFLMR 353
gi 94985425  274 P-------------VSL-QRALAlpRRFF-EDHHVILTRLWVR 301
gi 226357023 307 PRLSRGSDATEPLWLSL-SDAMStpELFF-EDHHAIIEHFLMR 347
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap