Conserved Protein Domain Family
PRK05322

?
PRK05322: PRK05322 
galactokinase; Provisional
Statistics
?
PSSM-Id: 235407
View PSSM: PRK05322
Aligned: 84 rows
Threshold Bit Score: 587.595
Threshold Setting Gi: 42527714
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
184154317   1 MDKQQFLAEYQDVF-KEPGKD--VFFSPGRINVIGEHTDYNGGHVFPCAISIGTYGVYGPREDTTVAIYSANSakeedSK 77 
56964983    1 MNTNELAAEFETIF-GSLPDQ--LFFAPGRVNLIGEHTDYNGGFVFPAALTMGTYLAVRRTNTNEFRLASQNF-----SQ 72 
15613670    4 AYKEDLLTSFAEAFsIDRLTDvrVFFAPGRVNLIGEHTDYNGGYVFPGALTNGTYMVIKLRDDGEYHLRSANF-----DT 78 
28210581    8 MNINELKKEFIKIY-GEGSMR--NFFSPGRVNLIGEHIDYNGGHVFPCALNFGTLGCVRKRKDNKVNLASTNI-----PL 79 
297545126   1 -MKTAVIEALEKFY-GRNEVEirVFYAPGRVNLIGEHTDYNGGYVFPCALDFGTYAAIRKRNDKKVFMASLNF-----DL 73 
289578904   1 -MKTAVIEALEKFY-GRNEVEirVFYAPGRVNLIGEHTDYNGGYVFPCALDFGTYAAIRKRNDKKVFMASLNF-----DL 73 
167039736   1 -MKTAVIEALEKFY-GKNDAEirLFYSPGRVNLIGEHTDYNGGYVFPCALDFGTYAAIRKRNDKKVFMASLNF-----DL 73 
167037025   1 -MKTAVIEALEKFY-GKNDAEirLFYSPGRVNLIGEHTDYNGGYVFPCALDFGTYAAIRKRNDKKVFMASLNF-----DL 73 
304316175   1 -MATKIVEEFKRIYgSSEGVR--LFYSPGRVNLIGEHTDYNGGYVFPCALDFGTFMAIRMRDDGKVRLSSLNF-----DL 72 
239827439   1 -MITNLIKTFTELF-GDGNEEirIFFAPGRVNLIGEHTDYNGGHVLPCALEIGTYALVRKTAHPFIRFYSKNFp---eTG 75 
184154317  78 IITFDINDTEPQNAKDekWVNYFKGMLVYLKQRGFKIDHGFNLYIHGFLPYGSGLSSSASIEMLMGNILKDEFNL-DIDE 156
56964983   73 RVAFPNKELSYNKEDD--WGNYPKGVIAYFQHHGFDL-GGADLYFFGNIPNGAGLSSSASIEMVTAYMISSLTGA-NWDR 148
15613670   79 SVVFRNSDLRFDPKDD--WGNYPKGIIAELAKLGVDL-PGATIYFYGNIPNGAGLSSSASIGMVTAYGLTQCSGI-DIDR 154
28210581   80 KVSINLEDIKYEKKHG--WGNYPKGVIKEIIDKGYKV-GGMDILISGNIPNGSGLSSSASLELLIAIMINNIFNDgKLDK 156
297545126  74 KVEVDLDALNFDKSHD--WANYPKGVLKVLQDEGYDF-SGFEIVFEGNIPNGAGLSSSASIELVTAVAVNEVFNL-NIDR 149
289578904  74 KVEVDLDALNFDKSHD--WANYPKGVLKVLQDEGYDF-SGFEIVFEGNIPNGAGLSSSASIELVTAVAVNEVFNL-NIDR 149
167039736  74 KVEVDLDALNFDKSHD--WANYPKGVLKVLQDEGYDF-SGFEIVFEGNIPNGAGLSSSASIELVTAVAVNEVFNL-NIDR 149
167037025  74 KVEVDLDAFIYDKSHD--WANYPKGVLKVLQDEGYDF-SGFEIVFEGNIPNGAGLSSSASIELVTAVAVNEVFNL-NIDR 149
304316175  73 KVEVNINDLVYDRKDD--WANYPKGVLKVLQDEGYKL-KGFEALYEGNIPNGAGLSSSASIELVTGVAMNEILNL-GIER 148
239827439  76 IITVSYDDLSYQDKHG--WANYPKGVIAAFQ-SFYPIETGLDILYYGTIPNGAGLSSSASIELVTAVMMNELFEQ-HIDM 151
184154317 157 IELVKLGQKTENDFVGLNSGIMDQFAVGMGKENNAIYLDCNTLEYKYLPLELGDYEIIIMSTNKNHSLAGSKYNERVQEC 236
56964983  149 LDLVKACQHVENNFIGVNSGIMDQFAVGMGKADHALFLQTDSLQYELVPLTLGNYDIVITNSNKRRGLADSKYNERRAEC 228
15613670  155 VTLAKLCQRMENDFIGVSTGLMDQFAVGMGKKDHALFLNTSSLEYDQVPLILKGYKLVITNSNKRRGLADSKYNERRREC 234
28210581  157 VELIKLSQKAENDFVGLNCGIMDQFAVAMGKKDMAILLDCNTLEYKYAPVDLGNYVITIMNTNKRRELSDSKYNERRLEC 236
297545126 150 IELVKMCQKAENTFVGVNCGIMDQFAVGMGKKDHAILLKSDTLEYSYVPLKLEGYKILITNTNKRRGLLDSKYNERRSEC 229
289578904 150 IELVKMCQKAENTFVGVNCGIMDQFAVGMGKKDHAILLKSDTLEYSYVPLKLEGYKILITNTNKRRGLLDSKYNERRSEC 229
167039736 150 IKLVKLCQKAENTFVGVNCGIMDQFAVGMGKKDHAILLKSDTLEYSYVPLKLEGYKILITNTNKRRGLLDSKYNERRSEC 229
167037025 150 IKLVKLCQKAENTFVGVNCGIMDQFAVGMGKKDHAILLKSDTLEYSYVPLKLEGYKILITNTNKRRGLLDSKYNERRSEC 229
304316175 149 VELVKLCQKAENNFVGVNCGIMDQFAVGMGKADYAIFLKCDTIDYKYVPFKLDGYKIVISNTNKRRGLQDSKYNERRSQC 228
239827439 152 LELVKMSQKVENEYVGVNCGIMDQFAVGMGKRNHAILLNCQTLAYRYIPVAFNHCSIVIANTNKKRGLADSAYNERRSTC 231
184154317 237 EEAVKRL-NKKLDINKLGELDSDTFDQYTYLIDDDTLIRRARHAVSENERTKKAIDAMEKGDLEELGRLINASHVSLKYD 315
56964983  229 EQALADLqAAGLDIRTLSDVTPALLAKHHHAFSTATVAKRASHVVSENQRVLEAVTALKAGNLRDFGQLMNESHQSLAND 308
15613670  235 EIGLEQLrKKQTNLSHLGEVTEEMFAELGPVIEDELIYRRVRHVVTEDARVLAAVSALKAGELQTFGELMKASHLSLRED 314
28210581  237 EKALKLI-NKEKKINYLCELSLEEFESLKYLIKDNRVLNRATHVVYENERVKRAYYLLSKRNLKEFGKLLAESHFSLRDL 315
297545126 230 EKALSYL-QRALPIHNLSEVSIEQFEEYKHLIPEEVLVKRARHVITENQRVLEAVKALNDKDLIKFGKLMVESHNSLKND 308
289578904 230 EKALSYL-QRALPIHNLSEVSIEQFEEYKHLIPEEVLVKRARHVITENQRVLEAVKALNDKDLIKFGKLMVESHNSLKND 308
167039736 230 EKALSYL-QKALPVKNLSEITIEQFEEYKDLIPDEVLRKRAKHVITENKRVLDAVKALNDKDLIKFGELMVESHNSLRDD 308
167037025 230 EKALSYL-QKALPVKNLSEITIEQFEEYKDLIPDEVLRKRAKHVITENKRVLDAVKALNDKDLIKFGELMIESHNSLRDD 308
304316175 229 EMALSYL-KKELDVDNLGQVTLEEFDKYKYLIPDDVLLKRARHVVTEDERALDAVEALKDNDIKRFGQLMVESHNSLRDD 307
239827439 232 EAALLKL-KEHLNIESLGELTSEQLEQYDHLLS-PIEQKRARHAVTENERTIQAADALEKGDLARFGELMKQSHISLRDD 309
184154317 316 YEVTGKELDTLAENAWNQPGCLGARMVGGGFAGSAIAIVKKSEAENFKKNVGKIYRDKIGYDASFYDAEVVDGPHKL 392
56964983  309 YEVTGLELDALYQLQHRAPGCIGTRMTGAGFGGCTVSLVQTDKMEAFQAHVKKGYESEFGFQPSFYISRAGDGVTEL 385
15613670  315 YDVTGVELDTLFDLQASAPGCIGTRMTGAGFGGCTVSIVHEEEITAFQTVVSKGYEKKIGYKPTFYVTELGDGVNEW 391
28210581  316 YEVTGKELDAIVGEALNVSGCIGARMIGAGFGGCAIALVEKSKLDLFKKKVSNNYNKIIGYKPGFYTSEIGEGTYEI 392
297545126 309 YEVTGKELDTLVEEALKLKGVIGSRMTGAGFGGCTVSIVKEEEVPDFIKVVSKNYKQKIGYEPTAYITGVGEGAREI 385
289578904 309 YEVTGKELDTLVEEALKLKGVIGSRMTGAGFGGCTVSIVKEEEVPDFIKVVSKNYKRKIGYEPTAYITGVGEGAREI 385
167039736 309 YEVTGKELDTLVEEALKLKGVIGSRMTGAGFGGCTVSIVKEDAVEEFIKVVTHNYTQKIGYRPTVYITGIGEGAGEI 385
167037025 309 YEVTGKELDTLVEEALKLKGVIGSRMTGAGFGGCTVSIVKEDAVEEFIKVVTHNYTQKIGYRPTVYITGIGEGAGEI 385
304316175 308 YEVTGKELDTLVDEALKLDYVLGSRMTGAGFGGCTVSIVKEEFVEDFIKEVTNGYKEKIGYEPSMYVTGVGDGAKEI 384
239827439 310 YEVTGLELDTLVEAAWNHEGTIGARMTGAGFGGCTVNIVKDEFIPSFIEQVGNEYAKKIGYEASFYVVKIGDGAKEI 386
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap