Conserved Protein Domain Family
PRK05257

?
PRK05257: PRK05257 
malate:quinone oxidoreductase; Validated
Links
?
Statistics
?
PSSM-Id: 179979
View PSSM: PRK05257
Aligned: 304 rows
Threshold Bit Score: 448.814
Threshold Setting Gi: 116335009
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
237808270   1 MASIHADVTLVGGGIMSATLAMLIHRLDPALHICMIEQLPDIALESSGALNNAGTGHAGYCELNYTPHDKDGNVLIQRAL 80 
78778800    9 NDNSYFDAVLVGAGIMSSTLALLISEVLPDIKFLIIEKLKAPGSESTGAFNNAGTGHAANCELNYTPLDEKGNLKIDKAL 88 
159902958   8 GPEDRFDAVLIGAGIMSSTLAVLLHELDPCMRILIVERLDSPALESTSAFNNSGTGHAANCEFNYTPLQSNGRIEIEKAL 87 
157412832   9 NDNSYFDAVLVGGGIMSSTLALLISEVLPDIKFLIIEKLNAPGSESTGAFNNAGTGHAANCELNYTPLDEKGNLKIDKAL 88 
123968007   9 NDNSYFDAVLVGAGIMSSTLALLISEVLPDIKFLILEKLNAPGSESTGAFNNAGTGHAANCELNYTPLDEKGNLIIDKAL 88 
123965715   8 DKKNNYDAILVGAGIMSGTLALLLTEILPELKILIIEKLKIPGSESSGAFNNAGTGHAANCELNYTPLDDYGHLKIEKAL 87 
126695777   9 NDNSYFDAVLVGGGIMSSTLALLISEVLPDIKFLIIEKLNAPGSESTGAFNNAGTGHAANCELNYTPLDEKGNLKIDKAL 88 
161347554   8 NKNNCYDAILVGAGIMSGTLALLITEILPTIKILIIEKLNKPGSESTGAFNNAGTGHAANCELNYTPVDENGDLQIDKAL 87 
33239870    8 ASDTRFDAVLIGAGIMSSTLAVLLHELDPEMRILIVERLEAPALESSSALNNAGTGHAANCEFNYTPCHPDGSINIQKAL 87 
120554307   1 -----MNVIVIGAGIMGTTFATLAKELAPELDITILERLDSPGAGNSWSFNNAGTGHEANCELNYTP-VDGEVISVEKAL 74 
237808270  81 EINAAFEVSLQFWSHLVNADRENiTPSSFINRVPHLSAVWGQKDIDFLKARYTLLKSHHLFSEMKWSEDEQTLADWMPLM 160
78778800   89 SINRSFERSMSLWASLYESGKI--DIKKFLKFIPHISFVSGQDNISFLKKRFQKMTDNPEFIDMEFSTSFDEISSWAPLI 166
159902958  88 SINSSFERSLEFWASLAEMGRI--SPATFLNFLPHISFVWKEADLDFLKQRYLQLSSEVAFQRMEWSDDKAELKEWMPIV 165
157412832  89 SINRSFETSMSLWASLYEAGKI--DIKKFLKFIPHISFVSGQDNISFLKKRFQKMTENPEFIDMEFSTSFDEISSWAPLI 166
123968007  89 SINRSFETSMSLWASLYEAGKI--DIKKFLKFIPHISFVSGQDNISFLKKRFQKMTENPEFIDMEFSTSFDEISSWAPLI 166
123965715  88 SINRSFEKSMSLWASLYSSQKI--DIKKFLKFIPHISFVTGSENVSFLKKRFKKMTEYKEFEDMEFSSSFNQISSWAPLI 165
126695777  89 SINRSFETSMSLWASLYEAGKI--DIKKFLKFIPHISFVSGQDNISFLKKRFQKMTENPEFIDMEFSSSFDEISSWAPLI 166
161347554  88 FINRSFENSMSLWASLYSKGKI--DIKKFLKFIPHISFVTGTENISFLKKRFKAMSKYPEFADMEFSSSFNQIKSWAPLI 165
33239870   88 VINSAFERSLEFWASMTELGKL--SPKTFLNLVPHISFVNCEEDVLFLQQRYKKLSAINAFRDMEWSADKEELSEWIPLI 165
120554307  75 KIHAQFNVAKQFWAYLVRKGAIK-EPTSFINQTRHCTLV-SEPSIEELKLRFKEMSAHHFFEHMRFSEEFDEIKSWIPYT 152
237808270 161 MKGRQAEPKLAATRVEHGADVNFGALTRILVSYLQKnANFELLTNTRVVDLHRAHGAKkpWAVKVKNQNSAAKQT-IESP 239
78778800  167 TKDRNPSTQIAATRIGRGTDINFEALTKEYLSLVSLnKNVEIRYKTELVDLKKIDKKQ--WELEISS--EGRKTS-IRTG 241
159902958 166 MQGRPTSEKVAATRIQRGTDVDFGALTRAYFDSLEEsGSVHIRLSTEVIDIQRFGQDP--WKLF---LKSDLNSYcVEGK 240
157412832 167 TKDRNPSTQIAATRIGRGTDINFEALTKEYLSLVSLnKNVEIRYKTELIDLMKIDKKQ--WELEISS--EGRKTS-IRTG 241
123968007 167 TKDRNPSTQIAATRIDRGTDINFEALTKEYLSLVSLnKNVEIRYKTELVDLKKIDKKQ--WELEISS--EGRKTS-IRSG 241
123965715 166 TKSRNPLDEVAATRVKRGTDINFEVLTREYLKYISKnKNVEISYETELNDLKKTSNKE--WELNISM--EGRKVN-LKTS 240
126695777 167 TKDRNPSTQIAATRIGRGTDINFEALTKEYLSLVSLnKNVEIRYKTELVDLKKIDKKQ--WELEISS--EGRKTS-IRTG 241
161347554 166 TTCRDPLDKVAATRIKRGTDINFQALTREYLTYISKnKNVEIFYNTELIDLKKTDKKQ--WKLKVRS--LGKIVS-LNTS 240
33239870  166 MNNRNPDQKVAATRVKRGTDINFGALTLAYLETLQEsGAVELKLSTEVVDISRLQEET--WEISLAN-TAGTYC--VQAP 240
120554307 153 MDGRPHHEKMAATVVETGTDVNFGSLTEQMAEYATKqLGVKVEYGVHVKRVHRNPAGS--WLVETQT-RGAAVQ--HRAD 227
237808270 240 FVFLGAGGVALHLLQNSGIEEAAGYGGFPVSGQWLICQ-NQDLIRQHHAKVYSLAAVGAPPMSVPHLDTRIINGKPSLLF 318
78778800  242 YVFLGAGGKTINYLQKSKIPEAKSYGGFPVSGKWLICE-KKDLTEKHNSKVYGKADIGSPPMSVPHLDTRWIDNKKLLLY 320
159902958 241 FVFLGAGGGALSLLQKSGIPEGKFYGGFPVSGQWLVCN-ETQVTNNHNAKVYGNADVGSPPMSVPHLDTRWIRGRKSLLF 319
157412832 242 YVFLGAGGKTINYLQKSKIPEAKSYGGFPVSGKWLICE-KKDLTEKHNSKVYGKADIGSPPMSVPHLDTRWIDNKKLLLY 320
123968007 242 YVFLGAGGKTINYLQKSKIPEAKSYGGFPVSGKWLICE-KKDLTEKHNSKVYGKADIGSPPMSVPHLDTRWIDNKKLLLY 320
123965715 241 YVFLGAGGKTINYLQKSNIPEAKVYGGFPVSGKWLICE-ENSLTEKHNAKVYGRADIGSPPMSVPHLDTRWIEGKKFLLY 319
126695777 242 YVFLGAGGKTINYLQKSKIPEAKSYGGFPVSGKWLICE-KKDLTEKHNSKVYGKADIGSPPMSVPHLDTRWIDNKKLLLY 320
161347554 241 YVFLGAGGKTINFLQKSKIPEAKIYGGFPVSGKWLICE-EKSLTEKHNAKVYGKADIGSPPMSVPHLDTRWIEGKKFLLY 319
33239870  241 FLFLGAGGGALSLLQNSGIEEGKKYGGFPVSGQWLVCN-DSKLVKMHHAKVYGKSAIGAPPMSVPHLDTRWIGTERFLLF 319
120554307 228 ILFVGAGGGAFPILKKSHLPFARRFTGFPVGGRFLQAEiTEEQARQYRAKTYGKAEVGAPPMSVPHLDLRVADGRHYLLF 307
237808270 319 GPYAGFTTKFLKHGSPFDLAKSVRPHNLKSLIGAGKNNFDLTKYLVKEVFQTHSQRMQSLEAFIPNARAE-DWQLAHAGK 397
78778800  321 GPFAGFTTKFLKQSSYFDLFSSIKKNNIFSMLDVGFKNNDLINYLISQSLKNHNSRVDNLKNMMPSANPS-DWYLKNAGQ 399
159902958 320 GPFAGFNTKFLKYGSNWDLFRSIQMGNVGAMVQAGLENIDLIKYLYGQLQQDHISRVDSLQNFLPNAKSK-DWHLSLAGQ 398
157412832 321 GPFAGFTTKFLKQSSYFDLFSSIKKNNIFSMLDVGFKNNDLINYLISQSLKSHNSRVENLKNMMPSANPS-DWYLKNAGQ 399
123968007 321 GPFAGFTTKFLKQSSYFDLFSSIKKNNIFSMLDVGFKNNDLINYLISQSLKNHNSRVENLKNMMPSANPS-DWYLKNAGQ 399
123965715 320 GPFAGFTTKFLKQGSYLDLFNSLKKNNLLSMLDVGIKNNDLINYLFSQSIKSHKSRVENLRNMMPSADPS-NWYLENAGQ 398
126695777 321 GPFAGFTTKFLKQSSYFDLFSSIKKNNIFSMLDVGFKNNDLINYLISQSLKNHNSRVENLKNMMPSANSS-DWYLKNAGQ 399
161347554 320 GPFAGFTTKFLKKGSYLDLFSSIKKSNLFSMLDVGIKNNELINYLFSQSFKSHNSRVENLRNMMPSAEPS-NWYLENAGQ 398
33239870  320 GPFAGFNTKFLKNGSNWDFLRSIQFSNFAPMIQTGLRNFDLIKYLIGQLKLDHDDRIAVLKDFFPEARSS-NWTLSLAGQ 398
120554307 308 GPFASFKPVLEKGRGFIDYLKAMRLHDIPGLLSVAIEHFALVKYLVSETFKGEKSMLESLEKFAPGLSSRfDWKPIEAGQ 387
237808270 398 RVQIIKRcHHKW-GKLEFGTEIVAAEDGSLAALLGASPGASVSVKTMLDVLERCFPQQMQSAEWQDKLKTMIPSYG-RSL 475
78778800  400 RVQIIKK--TEGgGSLKFGTEIVNSSDGSLSALLGASPGASTAVSIMVEVLEKSVLLLNDKHNLQKKINDLIYPEL-SDS 476
159902958 399 RVQIIKK-TSKG-GKLKMGTEMVSSSDGSLAALLGASPGASTAVAIMIDLLRSSWGEKMSTKIWQDRLRRLIPSFG-EDL 475
157412832 400 RVQIIKK--TEGgGSLKFGTEIVNSSDGSLSALLGASPGASTAVSIMVEVLEKSVLFLNDKHNLKKKINDLIYPER-TAS 476
123968007 400 RVQIIKK-TEGG-GSLKFGTEIVNSSDGSLSALLGASPGASTAVSIMVEVLEKSVLFLNDKHNLQKKINDLIYPEL-SVS 476
123965715 399 RVQIIKK-TKKG-GSLKFGTEIVNAADGSLSALLGASPGASTAVSIMIEVLKKSCLFTLDKSILEQKISHLLYESE-LKN 475
126695777 400 RVQIIKK-TEAG-GSLKFGTEIVNSSDGSLSALLGASPGASTAVSIMVKVLEKSVFFLNDKHNLQKKINDLIYPEL-SDS 476
161347554 399 RVQIIKK-TKDG-GSLQFGTEIVNSGDGSLSALLGASPGASTAVSIMIEVLKKSCLFNADKFELEKKLSNLLYESE-IKN 475
33239870  399 RVQIIKK-TSKG-GVLKLGTEVVTSSDGSLAALLGASPGASTAISIMLEVLQRCWGKKMSTDIWQKRLRDLLPSFG-QDI 475
120554307 388 RVQIIKD------GDLQMGTEIIVSKDKTYGTILGASPGASVSPEVMLRALEQLFPAVFAGESARSKLKEMFPEDNlDTL 461
237808270 476 INDANLSASVRRYTLDTLKLSS 497
78778800  477 ENKSIYIKDIKKRNNSIFGFHP 498
159902958 476 NSNESMLKATRDRNDSLLGFGE 497
157412832 477 QKNSTFIKEIKKRNNSIFGFHP 498
123968007 477 ENYSTFIKEIKKRNNSIFGFHP 498
123965715 476 QNENDFLENLKKRNNSILGFHP 497
126695777 477 ENNSTFIKDIKKRNNSIFGFHP 498
161347554 476 ESDNNFLEIIKKRNNSILGFHP 497
33239870  476 NHDKSLLDKLRNRSDSLLGLR- 496
120554307 462 ISNPERYREIRDAVNSALGIQS 483
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap