Conserved Protein Domain Family
PRK05101

?
PRK05101: PRK05101 
galactokinase; Provisional
Statistics
?
PSSM-Id: 179937
View PSSM: PRK05101
Aligned: 124 rows
Threshold Bit Score: 653.529
Threshold Setting Gi: 90020744
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
152979555   1 MHPKSQSKQLFRQKYQKSPTLNVYAPGRVNIIGEHTDYNDGFVMPCAINYGTAISGAKRDDHRFNVYAADLD-EFDEFRL 79 
153001845  28 SDILAQLEQAFVQHFGYAAQQVCHAPGRVNLIGDHTDYNGGFVLPAAINFGTWVAGHTRNDRIINVVALDCAgERVSFSL 107
217972260   4 SDILVQLEQAFVQHFGYAAQQVCHAPGRVNLIGDHTDYNGGFVLPAAINFGTWVAGHTRNDRIINVVALDCAgERVSFSL 83 
196155055   1 -MDNQVLSSKFEAQYGEAPALIAHAPGRVNIIGEHTDYNEGFVFPAAINFGTWVAATKRADNDIVVTAMDYEnQQNQFSL 79 
117620488   1 MTPSQRVSAVFAEQFEQQPDLLVRAPGRVNLIGEHTDYNDGFVLPCAIDYETCVAIGLRDDSLVHVIAADYGnQRDLFDL 80 
145297310   1 MTPSQRVSAVFVEQFEQQPDLLVRAPGRVNLIGEHTDYNDGFVLPCAIDYETCVAIGLRNDSQVQVIAADYDnQRDRFDL 80 
237809373   1 MSLKEKVHAVFQNSFGCEPDLYVRAPGRVNLIGEHTDYNDGFVLPCAIDYETVVALQRRDDDKVVVVAADYAnQRDEFSL 80 
77360709    1 MPRTTMLISQFEQHFNCPPEQLFHAPGRVNLIGEHTDYNDGFVLPAAINFGTDIAAKARADRNINVLAIDCNsETNSFSL 80 
109896975   6 QQAIDDLNAIYLEVFQTPPTRHFQAPGRVNLIGEHTDYNDGFVLPCAINYQTLVAVTPREDDLVRVVAADYDnERDEFSL 85 
261820632   5 DSLRQLTESVFVRLFGYAPHAAIQAPGRVNLIGEHTDYNDGFVLPCAIDYQTVVSAAVRQDGIVRVIAVDYDnQLDEFDL 84 
152979555  80 DQpIIPNPSKKWTGYVRGVVKFVQERCPEFRqGADLVISGDVPLSSGLSSSASLEVAVGKFCQLLGDLPLNNTDIALIGQ 159
153001845 108 DD-IAFDKVSSWSNYVRGSLIALAKALPDFG-GADLVVKGNVPRGAGLSSSASFEVVILKTMAALYDLPLSGVQAALMGQ 185
217972260  84 DN-ISFDEVSPWSNYVRGSLIALVKALPDFG-GADLVVKGNVPRGAGLSSSASFEVVILKTMAALYDLPLSGVQAALMGQ 161
196155055  80 SD-INYDQEQGWANYVRGVVKVLKEAIPDFG-GANLLVTGNVPQGAGLSSSASFEVAILKALSALYELPLDGVQAALLGQ 157
117620488  81 DQpIGHHADQRWSDYIRGVVKYLQERGYPLR-GLNLVVSGNVPQGAGLSSSASLEVAIGQAFKEALGLAITQAEIALNGQ 159
145297310  81 HQpIEHHPSQRWSDYVRGVVKYLQERGQALH-GLNLVVSGNVPQGAGLSSSASLEVAIGQAFKEALGLHISQAEIALNGQ 159
237809373  81 SQpIEAHADQLWSNYIRGVVKYLLEKGLSLK-GLNMVVSGNVPQGAGLSSSASLEVAIGQAFNDAYQLGLTPAAIALNGQ 159
77360709   81 DK-IEFSQQQMWVNYIRGTLQALMQSYPNIS-GADLVVSGNVPQGTGLSSSASFEIALLKTFATLNNIPLDGVKAALMGQ 158
109896975  86 SSnIEPHPTQLWSNYIRGVIKHLQMRGLQCK-GVDMVVTGNVPQGAGLSSSASLEVAIGETFRQLFDLPLTSADVALNGQ 164
261820632  85 AKeIEPHPEYVWANYIRGTVKFLLARGLLLS-GMDMVVSGNVPSGAGLSSSASLEVAIGQTFKELNNLNISQLDVALNGQ 163
152979555 160 KAENRFVGANCGNMDQLISALGQADHLLMIDCRSLETVPTPVPEDIAVMIVNSHVKHDLVTGEYNTRRQQCETAAKFFGV 239
153001845 186 QAENEFVGCNCGIMDQMISAMGKQHNAMLLDCRSLEIQYARMPEDLAIIIVNSNVKRGLVDSEYNTRRGQCEQAAAFLGK 265
217972260 162 QAENEFVGCNCGIMDQMISAMGKQHNAMLLDCRSLEIQYARMPEDLAIIIVNSNVKRGLVDSEYNTRRGQCEQAAAFLGK 241
196155055 158 KAENTFVGCSCGIMDQLISAMGNEGMAMLLDCQSLAIEHSPLPDSHQIVIINSNVKRGLVDSEYNLRREQCEQGASLLGV 237
117620488 160 QAENQFVGCNCGIMDQMISASGKQDHALLLDCRSLETRLIPMPTDLAVLIVNSNVRRGLVDSEYNTRRQQCEAAARHYGV 239
145297310 160 QAENQFVGCNCGIMDQMISASGKQDHALLIDCRSLETRLIPMPSDLAVLIVNSNVRRGLVDSEYNTRRQQCETAARHYGV 239
237809373 160 EAENKFVGCNCGIMDQMISASGEKDHALLLDCRSLQTRLVKMPDDLAVLIVHSNVKRGLVDSEYNTRRAQCESAARYFGV 239
77360709  159 SAENNFVGCNCGIMDQLISSMGKQGHAMLLDCRSLTFEYAVIPKGMSLVIVNSNVKRGLVDSEYNTRREQCEAAAKHFNK 238
109896975 165 EAENQFVGCNCGIMDQMVSACGAQNNALLLDCRSLETQLISMPKELDVVIINSNVKRGLVDSEYNTRREQCEEAARILGI 244
261820632 164 QAENHFVGCSCGIMDQFISAQGRAGQAMLIDCRSLEGRSVRMLDGVDVLIVNSNVRRGLVDSEYNTRRQQCEAAARHFNV 243
152979555 240 KALRDVSIEQFQKREAE--LtalDPDTAKRARHIVTENQRVLDAAYALNHSDISRLGELMNASHVSMRDDFEITTPEIDY 317
153001845 266 ASLRDVTLAELNAAKAE--L---EPVLYRRAHHVISESIRTCDMLAALNRHDMAEISTLMAQSHRSLKNDFEVTTSQLDI 340
217972260 242 ASLRDVTLAELNAAKAE--L---EPVLYRRAHHVISESIRTCDMLAALNRHDMAEISTLMAQSHRSLKNDFEVTTSQLDI 316
196155055 238 SSLREASIEMLEEAKPH--M---PDVVYRRARHIITENARTLTASQALKSGDIETVSSAMAQSHVSMRDDFEITVPPIDY 312
117620488 240 KALRDLDLAALEAGKAG--L---DEVCYRRARHVVGDNSRTLAAADALAQGDLVRLGELMADSHAAMRDDFEITVPAIDG 314
145297310 240 KALRDLDLTALEAGKAG--L---DEVCYRRARHVVGDNTRTLAAADALESGDLVRLGQLMAESHAAMRDDFEITVPPIDG 314
237809373 240 KALRDVTLEQLQQAAEQgkL---EPVVYQRARHVITENERTLAAADALETGDLEKMGVLMAESHNSMRDDFAITVPAIDT 316
77360709  239 PALRDVTLEELEAEQAN--L---PPLIYKRAKHIVTENTRTKLALKALNVNDMVTMSQLMAQSHLSMKNDFDITTSQIDF 313
109896975 245 KALRDISLVDLQAQKDK--L---PEVVYRRAHHVVSDSERTLQAADALRAGDAKTLSRLMAESHASMRDDFEITVKPIDF 319
261820632 244 KALRDVSLSQFEAGIEG--L---DPVAIRRARHVITENRRTLEAADALARQDAHRLFTLMAESHVSMRDDFEITVPPIDT 318
152979555 318 LVELAQSVIGKSGGARMTGGGFGGCIVGLAPKDKVDAVRQIIAENYEKRTGLKESFYVCTASQGVHQC 385
153001845 341 LVSLLADKLGEHGGARMTGGGFGGCVVALTERSHVDKVLGTLAEDYHAATGLKADIYLCHAVDGAFVA 408
217972260 317 LVSLLADKLGEHGGARMTGGGFGGCVVALTERSHVDNVLATLAEDYHAATGLKADIYLCHAVDGAFVA 384
196155055 313 LVEIIDGVLGQTGGVRMTGGGFGGCVVALAPTDKVEAVKQVVADKYFGETGYNADIYVCTATQGAFA- 379
117620488 315 LVEIIKARIGTEGGVRMTGGGFGGCVVALLHPDKVAEVIAAVDAEYPARFGLKADSYVCRASAGAGKL 382
145297310 315 LVEIIKARLGREGGVRMTGGGFGGCVVALLRPAQVAEVIAAVDAEYPARFGIKADSYVCRASAGAGKL 382
237809373 317 LVEILQQHIGNDGGARMTGGGFGGCVVALLRPAQVDDVIAAVEAEYPAKTGLKPTCYVCKASDGAGIF 384
77360709  314 LVDITAQVLGDKGGVRMTGGGFGGCIVALTPDHLVEQVRNTIDTHYYAKTGLQADVYVCLASQGAFSN 381
109896975 320 IVATLAEYLGEHGGVRMTGGGFGGCIVALMPREMVAGAQQLIAERYEVETGYKETFYVCCASDGAGEV 387
261820632 319 LVALIQDYVGDRGGVRMTGGGFGGCIVALIPSALTDEVKQVIEREYPARTGLQPSIYLCQASGGAGRV 386
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap