Conserved Protein Domain Family
PRK04943

?
PRK04943: PRK04943 (this model, PSSM-Id:101587 is obsolete)
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase; Provisional
Statistics
?
PSSM-Id: 101587
View PSSM: PRK04943
Aligned: 8 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 22-Jul-2008
Updated: 31-Jul-2008
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
59711372    1 MITKTTRWPSPAKLNLFLYINGQQENGYHELQTLFQFIDLCDHLTITANQSGQITLAPDIPGVKTEDNLIWKAATLLQQH 80 
54309997   10 IFNRETHWPSPAKLNLFLYITGQRPNGYHELQTLFQFLDYGDTLTITATNTSAITINPAIEGVTTEDNLIYRAADALRQA 89 
15642181    6 MIHGTTVWPSPAKLNLFLYITGRRANGYHDLQTLFQFLDHGDELTITANNSGNITLSPALADVALEDNLIYKAAMALKNA 85 
147673745   1 MIHGTTVWPSPAKLNLFLYITGRRANGYHDLQTLFQFLDHGDELTITANNSGNITLSPALADVALEDNLIYKAAMALKNA 80 
156973546   1 MIDLSTRWPSPAKLNLFLYINGRTENGYHELQTLFQFVDHGDELTIQANDSGEITISPEIEGVPLKDNLIWKAATALQRF 80 
28897514    6 MIETSTRWPSPAKLNLFLYINGRTENGYHELQTLFQFVDHGDELTIQANHSGDVTISPEIEGVPLQDNLIWKAATALQNY 85 
27363737    1 MITSPTTWPSPAKLNLFLYINGRTDNGYHELQTLFQFLDHGDQLTITANDSGHITLTPDIVDLPVEQNLIWKAANALQKK 80 
37679111    6 MITSPTTWPSPAKLNLFLYINGRTDNGYHELQTLFQFLDHGDQLTITVNDSGHITLTPDIVDLPVEQNLIWKAANALKKK 85 
59711372   81 SQCEFGAHIEIEKILPMGGGIGGGSSNAATVLVALNFLWQLNLSNDTLAALGVKLGADVPIFVHGFAAFAEGIGEKLQPA 160
54309997   90 TGTMLGAHIEIDKILPMGGGLGGGSSNAATTLVALNYLWQTQLDLDKLADIGLALGADVPVFVKGFSAFAEGVGEKLLPA 169
15642181   86 AQSPLGADIQLHKVLPMGGGIGGGSSNAATTLVALNYLWQTGLSDDQLAEIGLALGADVPVFTRGFAAFAEGVGEELSAV 165
147673745  81 AQSPLGADIQLHKVLPMGGGIGGGSSNAATTLVALNYLWQTGLSDDQLAEIGLALGADVPVFTRGFAAFAEGVGEELSAV 160
156973546  81 ANCSYGAHIDLHKILPMGGGIGGGSSNAATALVALNYLWQTNLSDDELAEIGLALGADVPVFVRGFSAFAEGVGEKLSPA 160
28897514   86 AHCSFGAHIELHKVLPMGGGIGGGSSNAATTLVALNYLWQLNLTDDELAEIGLKLGADVPVFVRGFSAFAEGVGEKLSPA 165
27363737   81 TGCTLGANIHLNKILPMGGGIGGGSSNAATALVALNFLWQLGLSDDELADIGLKLGADVPVFVRGHAAFAEGVGEKLTPA 160
37679111   86 TGCTLGANIHLNKILPMGGGIGGGSSNAATALVALNFLWQLGLSDDELADIGLKLGADVPVFVRGHAAFAEGVGEKLTPA 165
59711372  161 TPKELWYVLIKPEVSIATVDVFTHPNLVRNTPKQPLNALLEATYVNDCEKIVRSVYPEVDYQLSWLLEYAPSRLTGTGAC 240
54309997  170 TPQEKWFLVTKPNVSIATVDIFTHPDLIRNTEKRSLKALLAGVYENDCEKIVRRLHPEVDKAVSWLLEYAPSRLTGTGAC 249
15642181  166 EPEEKWYLVVRPAVSIATKDIFTHPQLMRNTPKRDLASLLTTPYENDCEKIVRSLYPEVDKQLSWLLQYAPSRLTGTGSC 245
147673745 161 EPEEKWYLVVRPAVSIATKDIFTHPQLMRNTPKRDLASLLTTPYENDCEKIVRSLYPEVDKQLSWLLQYAPSRLTGTGSC 240
156973546 161 HPDEKWYLVVRPNVSIATADIFGHPDLTRNTPKRDLETLLNTPSVNDCEKIVRMLYPEVDKQLSWLLQYAPSRLTGTGSC 240
28897514  166 NPEEKWYLVVRPNVSIATADIFRHPDLTRNTPKRDLETLLNAPSVNDCEKIVRMLYPEVDKQLSWLLQYAPSRLTGTGSC 245
27363737  161 QPEEKWYLVVRPDVHIATVDIFTHPQLTRNTPKRSLETLLDSEYGNDCEKIVRMIHPKVDKQLSWLLQYAPSRLTGTGSC 240
37679111  166 QPEEKWYLVVRPDVHIATVDIFTHPDLTRNTPKRSLETLLDSEYGNDCEKIVRMIHPKVDKQLSWLLQYAPSRLTGTGSC 245
59711372  241 VFAEFNSEKEAQDVYSLIPDNATGFIARGMNTSPLNRTLEEYKSLCK 287
54309997  250 VFAEFSSQQEADAILKKLPDWLHGFVAKGVNTSPLMATLHVHSTDCQ 296
15642181  246 VFAEFSSRKDAQAVFAQLSDNVLAFVAQGRNVSPLRKTLADYQSAKI 292
147673745 241 VFAEFSSRKDAQAVFAQLSDNVLAFVAQGRNVSPLRKTLADYQSAKI 287
156973546 241 VFAEFSSKSEAETILAQLSDKVSAFVAQGRNISPLKETLAEYQSASH 287
28897514  246 VFAEFSSKSEAETILAQLSDKVSAFVAQGRNISPLKETLAEYQSASH 292
27363737  241 VFAEFNSRSEAESILAQLSDNVSAFVAQGRNISPLKETLADYLSAQN 287
37679111  246 VFAEFNSRSEAESILAQLSDNVSAFVAQGRNISPLKETLADYLSAQN 292
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap