Conserved Protein Domain Family
PRK04648

?
PRK04648: PRK04648 (this model, PSSM-Id:101555 is obsolete)
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase; Provisional
Statistics
?
PSSM-Id: 101555
View PSSM: PRK04648
Aligned: 8 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 22-Jul-2008
Updated: 31-Jul-2008
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
21241718   1 MDRIALMDAPDTDWSAWPAPAKLNLFLQITGRRADGYHLLQTVFRLLDWGDTVHLRVRSGGQIRRVGESLPGVAEDDDLV 80 
78046535   1 MDRIALMDASGRDWSAWPAPAKLNLFLQITGRRADGYHLLQTVFRLLDWGDTVHLRVRRDGQIRRLGESLPGVSEDDDLV 80 
58583227   1 MDRIALMNAPGTDWSAWPAPAKLNLFLQITGRRADGYHLLQTVFRLLDWGDTIHLRVRSDGQILRIGESLPGVAEDDDLV 80 
84625063   1 ------MNAPGTDWSAWPAPAKLNLFLQITGRRADGYHLLQTVFRLLDWGDTIHLRVRSDGQILRIGESLPGVAEDDDLV 74 
66769661   1 MDALALMSASNPAWSAWPAPAKLNLFLQIVGRRADGYHLLQTVFRLLDWGDTVHVRLRTDGQIQRIGASLPGVAEDDDLM 80 
21230345   1 MDALALMSASNPAWSAWPAPAKLNLFLQIVGRRADGYHLLQTVFRLLDWGDTVHVRLRTDGQIQRIGASLPGVAEDDDLM 80 
15839234   4 VDPVSVVVDDGVGWSAWPAPAKLNLFLQITGRRVDGYHELQTVFRLLDWGDTIHLRVREDGQIHRIGESVTGVVEADDLV 83 
28199879   4 VDPVSVVIDDGVGWSAWPAPAKLNLFLQITGRRVDGYHELQTVFRLLDWGDTIHLRVREDGQIHRIGESVTGVVEADDLV 83 
21241718  81 IRAARLLQSATGAQAGAEIRVDKRIPAGGGFGGGSSDAATVLVALNALWGLGLAADALAELGLQLGADVPVFVRGHNAWA 160
78046535  81 TRAARLLQSAAGTQAGAEIRVDKRIPAGGGFGGGSSDAATVLVALNALWGLGLAADVLAELGLQLGADVPVFVRGRNAWA 160
58583227  81 IRAARLLQSAAGAAAGAEIRVDKRIPAGGGFGGGSSDAATVLVALNALWGLALTADTLAELGLQLGADVPVFVRGRNAWA 160
84625063  75 IRAARLLQSAAGAAAGAEIRVDKRIPAGGGFGGGSSDAATVLVALNALWGLALTADTLAELGLQLGADVPVFVRGRNAWA 154
66769661  81 VRAARALQIHAGTALGAELRVDKRIPAGGGFGGGSSDAATVLVALNALWGLGLPVDTLAELGLRLGADVPVFVRGHNAWA 160
21230345  81 VRAARALQIHAGTALGAELRVDKRIPAGGGFGGGSSDAATVLVALNALWGLGLPVDTLAELGLRLGADVPVFVRGHNAWA 160
15839234  84 VRAAYLLKYATNVHLGADIFVEKRIPVGGGFGGGSSDAATVLLVLNALWHTRLDVAVLAALGLRLGADVPVFVHGCNAWA 163
28199879  84 VRAAYLLKHATNVYLGADIFVEKRIPVGGGFGGGSSDAATVLLVLNALWHTRLDVAVLAALGLRLGADVPVFVHGCNAWA 163
21241718 161 EGVGEQLTPISLPEAAYLLVDPGVHVPTPALFRSQELTRDAAPAKIADFASGSLLDNAFEPVLRRREPAVEAVFQALSRV 240
78046535 161 EGVGEQLTPISLPEAAYLLVDPGVHVPTPALFRSQELTRDAALAKIADFASGSLLDNAFEPVLRRREPAVEAVFQALSRV 240
58583227 161 EGVGEQLTPIALPEAAYLLVDPGVHVPTPVLFRSQELTRDAAPAKITDFASGSLLDNAFEPVLRRREPAVEAVFQALSRV 240
84625063 155 EGVGEQLTPIALPEAAYLLVDPGVHVPTPVLFRSQELTRDAAPAKITDFASGSLLDNAFEPVLRRREPAVEAVFQALSRV 234
66769661 161 EGVGEKLTPISLPQAAYVLVDPGIHVPTPVLFQSQELTRDAAPAKIADFASGSLLDNAFEPVLRRREPAIEAVFQALSRI 240
21230345 161 EGVGEKLTPISLPQAAYVLVDPGIHVPTPVLFQSQELTRDAAPAKIADFASGSLLDNAFEPVLRRREPAIEAVFQALSRI 240
15839234 164 EGVGECLTPMILPGAAYLLLDPGVCVPTRELFLDPDLTRDASPATIGDFIAGTAFGNAFEPVLRRRESAVAGALDVLSEV 243
28199879 164 EGVGECLTPMILPGAAYLLLDPGVCVPTRELFLDPDLTRDASPATIGDFIAGTAFGNAFEPVLRRRESAVAGALDVLSEV 243
21241718 241 GTPRLTGSGSGCFVEFATRAAAEQALAQLPGGLRAWVAEGASHSPLLDARDARQV 295
78046535 241 GTPRLTGSGSGCFVEFATRAAAEQALAQLPGSLRAWVVEGAAHSPLLDALDATQV 295
58583227 241 GTPRLTGSGSGCFVEFATRAAAEQALAQLPGSLRAWVVEGAAHSPLLDARDAMKV 295
84625063 235 GTPRLTGSGSGCFVEFATRAAAEQALAQLPGSLRAWVVEGAAHSPLLDARDAMKV 289
66769661 241 GTPRLTGSGSGCFVEFATRAAAEQAMAHLPGNLRAWVVEGAAHSPLLDALDAIQV 295
21230345 241 GTPRLTGSGSGCFVEFATRAAAEQAMAHLPGNLRAWVVEGAAHSPLLDALDAIQV 295
15839234 244 GFARVTGSGSGCFVEFSTRDEAECALERLPYGLCAWVADGASRSPLLDVLKTMEF 298
28199879 244 GFARVTGSGSGCFVEFSTRDEAECALERLPYGLCAWVADGASRSPLLDVLKTMEF 298
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap