Conserved Protein Domain Family
PRK04344

?
PRK04344: PRK04344 (this model, PSSM-Id:101511 is obsolete)
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase; Provisional
Statistics
?
PSSM-Id: 101511
View PSSM: PRK04344
Aligned: 52 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 22-Jul-2008
Updated: 31-Jul-2008
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
56418574    1 MRLSIKAPAKINLSLDVLYKRPDGYHEVKMVMTTIDLADRIELVALPeEDAIRIVSQNRFVPDDCRNLAYQAAKLLKETF 80 
116333122   1 MQLIEKAPAKINLGLDTPYHHQDGAEEWNMVMTSVDLADYVEIQTLTkHKRIRVASDSGFLPNDQRNLAFQAAHLLQTNY 80 
116496020  16 MELIEKAPAKINLSLDALYRHDDGEHEWQMVMTSVDLADYVMISP---HRSIQVSTDSGFLPEDPRNLAYKAALALQRHA 92 
28377360    1 MQIVEKAPAKINLGLDTLFEHPNGDKEWDMVMTSVDLADYVMLESLH-TNRIEVVTDSGFLPNDRRNLAFQAVSVLKRYC 79 
81429264    1 MQLIEKAPAKINLSLDALYQHTDGEFEWQMIMTSIDLADYVQITLQD-SPQIEVRTSKGYLPEDKRNLAYQAAQLLRHRF 79 
90961216    1 MEISEKAPAKLNLSLDTPFRHQDGEPEWRMVMTAIDLSDYVHIKTIPnSKEITVQTNTGFLPCDQRNLAYQAAKLLQSKL 80 
116871579   1 MKISITAPAKINLSLDALYKREDGYHEVEMVMTTIDLADRLSLERLD-EDKIVLDVKAHFIPEDRRNLIYQAALLLKKRF 79 
116492075   1 MEITEKAPAKLNLFLDTPFNHPDGLPEWNMIMTSVDLADYVKIESIPgKMGIKVRTNTGFLPNDSRNLAYQAARILQEKY 80 
25010224    1 MRIFEKAPAKLNLGLDIKGRCDDGYHELAMIMVSIDLNDYVTISELK-EDCIVIDSDSSKMPLNNDNDVFKAADIIKNQY 79 
22536338    1 MKIFEKAPAKLNLGLDIKGRCDDGYHELAMIMVSIDLNDYVTISELK-EDCIVIDSDSSKMPLNNDNDVFKAADIIKNQY 79 
56418574   81 SIRQGVAISITKHIPVAAGLAGGSSNAAATLRGLNKLWQLGLTLDELAELGAKIGSDVAFCVYGGTALATGRGEIITPIP 160
116333122  81 GIDEGVNIRIKKNIPVAAGLGGGSSDAAAVLRGLNQLWSLGLSWQELAELGLQIDSDVPYCVYGRTAHVRGRGERITPLS 160
116496020  93 NIRQGARIHIEKHIPVAAGLGGGSSDAAAVLRGLNSLWQLGYSRSQLARIGLSVDSDVPYCVYSETALVTGRGDVVTPLG 172
28377360   80 HVDRGVRIKIRKAIPVAAGLGGGSSDAAAVLRGLNRMWNLHLDLATLARLGLQVDSDVPYCVYSQTAHVTGKGDVVTPLP 159
81429264   80 DIKTGAIIEIDKHIPVAAGLGGGSSDAAAVLRGLNQLWHLGLTEAELAHIGLSIDSDVPYCVYSETALVTGKGDQIQPLG 159
90961216   81 DKPEGVEIEIDKHIPVSAGMGGGSADAAAVLRGLNKIWNLNMSREELAKLALTIDSDVPFCVYSEPALVTGRGEKITPIG 160
116871579  80 NVKMGVRIIIDKHIPVSAGLAGGSSDAAAALKGLNIIWELGLSIEELAEISSEIGSDIAFCVYGGTALATGRGEKITALP 159
116492075  81 HVRAKVIIEIRKHIPVAAGLGGGSSDAAAVLRGLNKLWNLELSLEVLAKIGLEIDSDVPFCVYSRTAHVLGKGEKVIPLK 160
25010224   80 GINKGVHIRLEKSIPVCAGLGGGSTDAAATIRALNRLWNLQMDYDEMVAIGFKIGSDVPYCLGGGCSLVLGKGEIVKPLP 159
22536338   80 GINKGVHIRLEKSIPVCAGLGGGSTDAAATIRALNRLWNLQMDYDEMVAIGFKIGSDVPYCLGGGCSLVLGKGEIVKPLP 159
56418574  161 SPPPCWVVLAKPPIGVSTAEVYRNLELERVS-HPDVDAMVRAIERQDYAAICRLVGNVLEEVTLKKYPEVAHIKEQMKRF 239
116333122 161 KLPAAWVVLAKPKVSVSTPSILQQIQYDHLE-HPDIDGLLRAIREQDIQGMCAVMGNALEPLTAHRYPEITQIKQQMMKF 239
116496020 173 SLPNFWVVLAKPRVSVSTPTILNAIDYDAGLrHPDTQTVVAGIQNHDFAQMTSGMANSLEAITASRYPEMSALKQRLQKY 252
28377360  160 KLPPMWIILAKPKVSVSTPNILRQVNYERIDqHPNIEALLAGIQQQDFAEIFANMGNVLEPITAKRYPEILQIKRQLLTF 239
81429264  160 DLPNFWMVVVKPEVSVSTPRILHALNCDQITdRPQTDRLLAGIQQQDAQQMTAAMANVLTPITNQRYPQIDYLMQRLTAF 239
90961216  161 PLPPMWLVIAKPQASVSTPTILRQIHEQHLN-HQEVQNVVSAIKQQDFDKMCRHMGNALEPITMKKCPDIIKIKDKMLQF 239
116871579 160 NIPGCWIVLAKPSISVSTPTIYKELQVENVE-HPNTKKMIESIKIGDLDGIFASTGNVLESVTLEKNPQVKRIKDRMMAF 238
116492075 161 KLPPMWVVIAKPKLSVSTPYILSKIEHKELQ-HSNIESILDAIEREDYTDICRYMGNVLEQVTGKEHPEVLKIKNRIKQY 239
25010224  160 TLRPCWIVLVKPDFGISTKSIFRDIDCKSIS-RVDIDLLKSAILSSDYQLMVKSMGNSLEDITITKNPVISTIKERMLNS 238
22536338  160 TLRPCWIVLVKPDFGISTKSIFRDIDCKSIS-RVDIDLLKSAILSSDYQLMVKSMGNSLEDITITKNPVISTIKERMLNS 238
56418574  240 GADAVLMSGSGPTVFGLIEHDSRMQRVYNGLRGFCDQVFAVRMLGE 285
116333122 240 GADAAQMSGTGPTVFGLCSKQSRAQRVFNGMKGFCREVYLVRPLP- 284
116496020 253 GAEFAQMSGSGPTVFGLCQKHSRAMRVYNSMKGFCREVYLLRPFCL 298
28377360  240 GADAAQMSGTGPTVFGVCRKQSRAQRVYNSLKGFCREVYLVRPVNL 285
81429264  240 GAEKAQMSGSGPTVFGICRQYSRAQRIYNSMSGFCREVYLVQPLKK 285
90961216  240 GADAAQMSGSGPTVFGISQKKSRATHIYNSLRGFCKEVYLVRALDS 285
116871579 239 GAEAALMSGSGPTVFALIKQYSRAKRVYNGLRGFCEEVYMVRPWSE 284
116492075 240 GADAAQMSGTGPTVFGVASKSSRAKHIVNSLKGFCHEVYLVRIL-- 283
25010224  239 GADVALMTGSGPTVFSMCSTEKKADRVFNSMKGFCKEVYKVRLLR- 283
22536338  239 GADVALMTGSGPTVFSMCSTEKKADRVFNSMKGFCKEVYKVRLLR- 283
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap