Conserved Protein Domain Family
PRK04262

?
PRK04262: PRK04262 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 235266
View PSSM: PRK04262
Aligned: 82 rows
Threshold Bit Score: 428.171
Threshold Setting Gi: 78044902
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
294494851   1 MSVGIVSYGTYIPKYRIKVEDIAKVW-GDNadilSAGLMVNEKSVPDLDEDTVTIAVEASRAAICRSSLDPSRIGAIYTG 79 
70733239    4 KKIGIVSYGAGIPVCRLKVQEVINVWkNTDlklvEENLGVTERAVLQPDEDVITLGVLAAQRALDK--VPGHQIEALYLG 81 
284998059   1 MLSGILGWGAYVPRYRIKVEDIAKMW-GYDeg-vVRSLGLTEKSVPGHDEDSTTIAWESSINAIKRAQVDPSKIRLVLFG 78 
238620027   1 MLSGILGWGAYVPRYRIKVEDIAKMW-GYDeg-vVRSLGLTEKSVPGHDEDSTTIAWESSINAIKRAQVDPSKIRLVLFG 78 
227827854   1 MLSGILGWGAYVPRYRIKVEDIAKMW-GYDeg-vVRSLGLTEKSVPGHDEDSTTIAWESSINAIKRAQVDPSKIRLVLFG 78 
229585124   1 MLSGILGWGAYVPRYRIKVEDIAKMW-GYDeg-vVRSLGLTEKSVPGHDEDSTTIAWESSINAIKRAQVDPSKIRLVLFG 78 
227830564   1 MLSGILGWGAYVPRYRIKVEDIAKMW-GYDeg-vVRSLGLTEKSVPGHDEDSTTIAWESSINAIKRAQVDPSKIRLVLFG 78 
229579377   1 MLSGILGWGAYVPRYRIKVEDIAKMW-GYDeg-vVRSLGLTEKSVPGHDEDSTTIAWESSINAIKRAQVDPSKIRLVLFG 78 
146304409   1 MHTGIIGWGSYVPKYRIKVSDIASVW-GKEeg-vVKALGLTEKSVPAADEDSTTMAIEASRDALTRAMIDPREVEMALFG 78 
305662896   4 HRCGIVGWGVYIPRYRIKAEEIARLW-GFNee-aTKGIWIEEKSVADIDEDSVTIGYRASLYAIKRAGIDPRNIDAVYLG 81 
294494851  80 SESHPYAVKPTSTIVAEAVEATPEMTAADLEFACKAGSAGIQACMGLVQSGMADLGLAIGSDV--SQGAPGDALEYTAAA 157
70733239   82 TCTNPYDSRASASIILEMLGSGYDAYCADVQFAGKSGTSALQICQALVASGMTGSALAIGADTinRNTAPGDLTESYAGA 161
284998059  79 SESKVYAVKPTSTILIDALGINNYSATADMEFACRAASVGLRLASSFVLHNSDSYALVIGADT--AQSNPGDVLELSSAA 156
238620027  79 SESKVYAVKPTSTILIDALGINNYSATADMEFACRAASVGLRLASSFVLHNSDSYALVIGADT--AQSNPGDVLELSSAA 156
227827854  79 SESKVYAVKPTSTILIDALGINNYSATADMEFACRAASVGLRLASSFVLHNSDSYALVIGADT--AQSNPGDVLELSSAA 156
229585124  79 SESKVYAVKPTSTILIDALGINNYSATADMEFACRAASVGLRLASSFVLHNSDSYALVIGADT--AQSNPGDVLELSSAA 156
227830564  79 SESKVYAVKPTSTILIDALGINNYSATADMEFACRAASVGLRLASSFVLHNSDSYALVIGADT--AQSNPGDVLELSSAA 156
229579377  79 SESKVYAVKPTSTILIDALGINNYSATADMEFACRAASVGLRLASSFVLHNSDSYALVIGADT--AQSNPGDVLELSSAA 156
146304409  79 SESKVYAVKSTSAILIDALGLSKFSLTADLEFACRAASAGLRMAFSMVESGQVSYSLVVGSDT--AQSNPGDVLELSSAA 156
305662896  82 TESKPYAVKPGASIIAEALGISPRHQVADLEFACRAGAEAIRIGIALVDSGQARYVLAIGADT--SQSSPGDVLEFTVSA 159
294494851 158 GGAAYIIGn-kEEEMVAIIEDTYSFTTDTPDFWRREGMPYPEHGGRFTGEPGYF---KHVLGAAKGLMNKLGTSAEDYDY 233
70733239  162 GAAALLIG---SQDVIAEFDASFSCAADVADNIRPQGDRYIRSGMGLGSDKNSIgleDQTRRAAEGLMAKLHTSPADYDY 238
284998059 157 AGVAFVVGnvdEKHSAAVIEYSSSYTSDTPDFWRRDGTPYPVHGEGFTGEPAYF---HHIISAVSDLLQNSGLKISDFDY 233
238620027 157 AGVAFVVGnvdEKHSAAVIEYSSSYTSDTPDFWRRDGTPYPVHGEGFTGEPAYF---HHIISAVSDLLQNSGLKISDFDY 233
227827854 157 AGVAFVVGnvdEKHSAAVIEYSSSYTSDTPDFWRRDGTPYPVHGEGFTGEPAYF---HHIISAVSDLLQNSGLKISDFDY 233
229585124 157 AGVAFVVGnvdEKHSAAVIEYSSSYTSDTPDFWRRDGTPYPVHGEGFTGEPAYF---HHIISAVSDLLQNSGLKISDFDY 233
227830564 157 AGVAFVVGnvdEKHSAAVIEYSSSYTSDTPDFWRRDGTPYPVHGEGFTGEPAYF---HHIISAVSDLLQNSGLKISDFDY 233
229579377 157 AGVAFVVGnvdEKHSAAVIEYSSSYTSDTPDFWRRDGTPYPVHGEGFTGEPAYF---HHIISAVSDLLQNSGLKISDFDY 233
146304409 157 AAVAFVVGr--AEEASAVVEASTSYVTDTPDFWRRDGMPYPLHGEAFTGEPAYF---AHIYEAVNRLLQDTGLKVSDFDY 231
305662896 160 GGAAYIVGp--IEESVAIFEGSTTYSTDTPDFWRREGATYPRHGEGFTGEPAYF---SHIMNAVKQLMEELGLKPSDFDY 234
294494851 234 AVFHQPNGKFPSRVAKMLGFSKEKIAPGLLVTRLGNTYSGSCLMGIAATLDQAKPGDRIFATAFGSGAGADAFSFRVTDK 313
70733239  239 VVFQQNLVSTPYSLAKHLGFNPKQVEPGIYAGNVGDAGSASPLLGLINVLDQARPGQKILLVSYGFGAGSDAIALTVTDA 318
284998059 234 FVFHQPNGKFPIQVAKKLGVQLEKVKQGLVSPYIGNPYNASALLGLAKVLDIAKPGERILVAPFGSGAGSDAFSILVSEG 313
238620027 234 FVFHQPNGKFPIQVAKKLGVPLEKVKQGLVSPYIGNPYNASALLGLAKVLDIAKPGERILVAPFGSGAGSDAFSILVSEG 313
227827854 234 FVFHQPNGKFPIQVAKKLGVPLEKVKQGLVSPYIGNPYNASALLGLAKVLDIAKPGERILVAPFGSGAGSDAFSILVSEG 313
229585124 234 FVFHQPNGKFPIQVAKKLGVPLEKVKQGLVSPYIGNPYNASALLGLAKVLDIAKPGERILVAPFGSGAGSDAFSILVSEG 313
227830564 234 FVFHQPNGKFPIQVAKKLGVQLEKVKQGLVSPYIGNPYNASALLGLAKVLDIAKPGERILVAPFGSGAGSDAFSILVSEG 313
229579377 234 FVFHQPNGKFPIQVAKKLGVQLEKVKQGLVSPYIGNPYNASALLGLAKVLDIAKPGERILVAPFGSGAGSDAFSILVSEG 313
146304409 232 FVFHQPNGKFPFQMAKKLGVPLEKVKQGMVSTLIGNPYNASALLGFARVLDVAKPGQRVLVAPFGSGAGSDAYSFVITDK 311
305662896 235 AVFHQPNGKFPLRVASMLGIPREKVLPGLLTPYIGNTYNGSVLIGLAKVLEEAKPGQRILVASFGSGAGSDAFSIIVTDK 314
294494851 314 IDKIRDKAPRVEELLANPVYMDYAMYAKHKGKIKR 348
70733239  319 IEQYQKHNKPLRELLESKIYVDYGTSIKYEFKYLR 353
284998059 314 ILEKQKLAKTVEYYINNKKLVSYAEYAKYTNKIKV 348
238620027 314 ILEKQKLAKTVEYYINNKKLVSYAEYAKYTNKIKV 348
227827854 314 ILEKQKLAKTVEYYINNKKLVSYAEYAKYTNKIKV 348
229585124 314 ILEKQKLAKTVEYYINNKKLVSYAEYAKYTNKIKV 348
227830564 314 ILEKQKLAKTVEYYINNKKLVSYAEYAKYTNKIKV 348
229579377 314 ILEKQKLAKTVEYYINNKKLVSYAEYAKYTNKIKV 348
146304409 312 ILERQKLAHTTDYYIQRKKLVDYASYAKTTHKFKV 346
305662896 315 IYEKIDRAPRVEYFVKNKKYISYQEYAKMRGLIKA 349
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap