Conserved Protein Domain Family
PRK04181

?
PRK04181: PRK04181 
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase; Provisional
Statistics
?
PSSM-Id: 235243
View PSSM: PRK04181
Aligned: 27 rows
Threshold Bit Score: 241.789
Threshold Setting Gi: 32265621
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
291277166   3 LDVFPKVNVFLKILGQDvLGYHHLVSRFCLVQGGLRDVMEV--REGSGFALRGNFDCeiQQNTIYKAIISLKmmlstQNK 80 
32265621    1 --------------------------------------MNI--THYSCFTLQGDFDCeeKDNLIYKAKCVLQdfldiQG- 39 
15612401    5 FEVYPKVNVFLKILHKE-GAYHKIISRMCLVKNKLKDIISV--KNALSFSLKGDFDCplEENSLFKALQVLKkflvqKNF 81 
108563794   5 FEVYPKVNIFLKILHKE-GAYHKLISRMCLVKDKLKDIISV--KSALSFSLKGDFDCplEENSLFKALQILKnflksKNF 81 
298735591   4 FEVYPKVNIFLKILHKE-GAYHKLISRMCLVKDKLKDIISV--KNALSFSLKGDFDCplEENSLFKALQILKnflksKNF 80 
109946798   5 FEVYPKVNIFLKILYKE-GAYHKLISRMCLVKGQLKDIISV--KNAPSFCLKGNFDCplEENSLFKALQILKnflksKKL 81 
34557273    1 ----------MKILGQK-GSYHELASRFWRVESLFDEMEWIe-SSSGSFEIRSTLSCpvEQNSIYKAKEALL-----PRL 63 
157738286   3 EKSYAKVNIFLKIANKR-DNYHELVSRFVRVHSLYDKISFIk-SKRKAFEIIGNFGCklETNTIFKAYQLIKs------- 73 
296271996   5 AKSYAKVNIFLKIAGKR-DNYHELVSRFVRVKNLYDTITFIpeNSTNEFNLIGDFGCetQKNTIYKAFLAL------RDN 77 
268680249   3 YHAHAKINIFLKIVGTR-GNYHTLISRFMRVSHLFDTLSFVpkTSSAPFELVGDFNCslEHNTVYKIFQTLQr----HGF 77 
291277166  81 DARILDFLE---IEVEKNIPTKAGLGGGSADAGVLLHALNRAY-FDLRPEQLLCVAREVGADVSFFAMGCGSANVSGIGD 156
32265621   40 QKTAVKAIEcvkIEVQKSIPKGAGLGGGSGNAGAFLIGVNNFFgLGLSQKQLMAVGEKIGADVAFFVSGEESANVSGKGQ 119
15612401   82 SHSVIKSLDtlaIEVEKNIPTQAGLGGGSADAGGLLYHLNQMFdWRLSLKELYTMGSLVGADTNFFISQYKSANATSYGE 161
108563794  82 SHSAIKSLDtlaIEVEKNIPTQAGLGGGSADAGGLLYHLNHIFdWRLSLEELYSMGSLVGADTNFFISQHKSANATSYGE 161
298735591  81 SHSIIKSLDtlaIEVEKNIPTQAGLGGGSADAGGLLYHLNQIFdCRLSLKELYSMGSLVGADTNFFISQYKSANATSYGE 160
109946798  82 SHSVIKSLDtlaIEVEKNIPTQAGLGGGSTDAGGLLYHLNQIFdLRLNLEELYTIGSLVGADTNFFISQYKSANATSYGE 161
34557273   64 KESERREIEkrgISLQKRIPEGAGLGGGSSNAATFLLMAKESLgLSLSLEELAEVGERVGADVPFFVFGYPSANVRGIGE 143
157738286  74 yKGVEDFFQeysVEVEKNIPEFAGLGGGSSNAATFLIMANKYCkLNLSKDDLCKIAVKIGADVPFFVYEYDSANVTGIGE 153
296271996  78 CPKIDAYFRiysIKVDKKIPEFAGLGGGSSNAATFLIMANKLFdLYYSKEKLAKIGAKIGADVPFFIYEYDSANVTGIGE 157
268680249  78 AKDVEAIMKeyaLHVKKVIPQGAGLGGGSSDAATFLHMLNDVGnLNLSLQEQMELGSRVGADVAFFASGYESANVSGIGE 157
291277166 157 CVMVYEEEELD--FEIFTPE-FSCETKRVYQAYDtwqksqKHGIKKSSveksMiKDSKELSDIKSREILES-FTRTSLND 232
32265621  120 YIQSLNEKPLQ--YSIYTPPhIFCDTTKVYKCYAdsikahKRSY--------S-APANEWFAKTSLELLSNhFSKSTLND 188
15612401  162 VIENFEEESLEdrLEIYAPNhVFCSTKAVYQAYK------PETC--------F-FQAKEWLKKTSLECLKT-YDRNELND 225
108563794 162 VIENFEEEPLEnrLEIYAPNhVFCSTKAIYQAYK------PETC--------F-SQTKEWLKKPSLECLKT-CDRSELND 225
298735591 161 VIENFEEEPLEnrLEIYAPThVFCSTKAIYQVYK------PETC--------F-SQAKEWLKKPSLECLKT-YDRSELND 224
109946798 162 VIENFEEKPLEnrLEIYVPDnIFCSTKAVYQAYK------PKTC--------F-YQAKEWLKKPSLECLKT-CDRSELND 225
34557273  144 IVEPFEENLME--VELFMSG-IIANTARVYEAFR------TSFLPKLDlrwqR-QEAERWLESSGETILQS-QDPLSLND 212
157738286 154 IVEKFDEEILN--IETITPN-IKCNTGQIFKIFR------EKFYKEIS----K-EEANKLLSMKSIDILKQ-FGIEDAND 218
296271996 158 IVEKYEEEALD--IEVVTPK-IECNTGKIFTSFR------ESFYKEIS----S-EDKSRLLNMSSKDILKE-LDIFEAND 222
268680249 158 VVEKCDEVALD--LEVFTPP-LACETARVYKMYR------EYFLQSMN----I-PLAHVMVDMKSEALLKA-YGREALND 222
291277166 233 LLAPALSEYPGLAEIeagLGREWFFSGSGSSFFRIRR 269
32265621  189 LYESACEIYPHLRDIaqeLGEGWYFSGSGSSFFRQEQ 225
15612401  226 LLKPALRTNPALKDIesqLSKEWFFSGSGSAFFRLKN 262
108563794 226 LLKPALLTNQALRDIeseLGKEWFFSGSGSAFFRLKN 262
298735591 225 LLKPALCANPALKDIesqLSKEWFFSGSGSAFFRLKP 261
109946798 226 LLKPALLTHQALKDIesqLGKEWFFSGSGSAFFRLKP 262
34557273  213 LYAPALLLYPELGEY---AHTGRFFSGSGSTFFAPAG 246
157738286 219 LYESALSLYPQLGDY---EKKDWYFSGSGSSFFRINN 252
296271996 223 LYEPAIQSYSQLGDY---AKKDWFFSGSGSSFFKVKD 256
268680249 223 LYLACLKAYPVLASY---AKEGWFFSGSGSSFFRMKE 256
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap