Conserved Protein Domain Family
PRK04152

?
PRK04152: PRK04152 (this model, PSSM-Id:101424 is obsolete)
histidinol-phosphate aminotransferase; Provisional
Statistics
?
PSSM-Id: 101424
View PSSM: PRK04152
Aligned: 19 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 22-Jul-2008
Updated: 31-Jul-2008
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118474105   1 MKFNSHIENLPIYEAGKPIELVIREFGIDQNDIIKLASNENPLGTSKKVIEKIKNVAQNSSLYPDDSYYELKDGLSNLYK 80
gi 157738338   1 MRFNEVLKDVSTYEAGKPIELVVREYGIDSKDVIKLASNENPYGTSPKVIAKIQELAKNMCLYPDDSMYELKDALAKKYN 80
gi 154174754   1 MKFNENLAGLVNYEAGKPIELVVREFGIEAKDVIKLASNENPFGTSPHVVEAIKSAASNAFLYPDDSYFELKEALGAKFG 80
gi 32266111    1 -MFRSALKQIVTYEAGKPIELVVREYGIKPEDIIKLGSNENPYGTSAQVVESLQKNAHKAFLYPDDSMYELKNALASHFD 79
gi 152990139   1 MRFNETLEKIKTYEAGKPIELVVREFGIEPQNIIKLASNENPYGTSPKVVDAVREIADTMYMYPDDSMFELKSALAKRFE 80
gi 78776672    1 MKFNKHLQNIKTYEAGKPIELVVREYGIEPQDIVKLASNENPLGCSPKVIDAVGKILTKMSLYPDDSMISLKNALSKRYN 80
gi 152993633   1 MKFNKVLENIQTYEAGKPIELVVREFGIAPKDVVKLASNENPIGTNPAITKVIRSNADIAHLYPDDSMFELKEALSRKFD 80
gi 34558287    1 MQFNPTLDSIKTYEAGKPIELVVREYGIKPQNVIKLASNENPFGASPKVIEAIAKEAVNAHRYPDDSMFELKEGLAGRFG 80
gi 45658350    5 IPFRSILNSLKSYEAGKPIELVVREFGIDPNRIIKLGSNENPFGCAESVMEVVRQAISKMSFYPDDSYLDLKTAIASKFD 84
gi 24213881    5 IPFRSILNSLKSYEAGKPIELVVREFGIDPNRIIKLGSNENPFGCAESVMEVVRQAISKMSFYPDDSYLDLKTAIASKFD 84
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118474105  81 VEPKNVIIGSGSDQIIEFALHAKANEKKGILVSGVTFAMYEIYAKHVGAKIYKTKSKEHNLAEFREIYRTNKNd--iSVI 158
gi 157738338  81 LESSNIIIGSGSDQILEFCIHAKCKKDSKILMAKTTFAMYEIYGKHVGAEIIKTNSEQHNLEEFSELYKKHGA----DII 156
gi 154174754  81 VGTKNIIIGSGSDQIIEFCLHAKANPQSAVLMAGVTFAMYEIYAKQVGAKIYRTRSQEHDLAEFLEIYEAHKDe--iSVI 158
gi 32266111   80 VESKHIIIGAGSDQIIEFCMQALNHHNAQVLMAKTTFAMYEVYAKLAGVEISKTPSDEHILEEFFQLYQSEKErkhiSAV 159
gi 152990139  81 IDQKNIIIGAGSDQVLEFCARAVLNEKSSVLMSKITFAMYEIYALQQGAKIIRSSCYRHDLEEFYDLYKKHHP----DII 156
gi 78776672   81 VDSENVIIGSGSDQVIEFLIHAKAHSGSKILMNSITFAMYEIYSKHVGADVIRTSSQEHDLDEFYELYKQEKP----EII 156
gi 152993633  81 VEDENIIIGAGSDQVLEFISRALLNEASSVLMSAVTFAMYEIYAKQMGAKIIRTESYEHKYDEFIEAYHTYKP----KII 156
gi 34558287   81 VKSENVIIGSGSDQILEMAVHAKCNASSKVLMSKTTFAMYDVYSRQVGARILRTPSDQHHLGEFWEIYQKERP----EIL 156
gi 45658350   85 LTTDRIIPGNGSDQVLDFVCRCVLDQGDSVLINRITFAMYKIYALQCGAKIHSTDSVTHDLNAFLDLAKLIRP----KII 160
gi 24213881   85 LTTDRIIPGNGSDQVLDFVCRCVLDQGDSVLINRITFAMYKIYALQCGAKIHSTDSVTHDLNAFLDLAKLIRP----KII 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118474105 159 FLCLPNNPLGECLDADEVFSFIKDVSEDTLVVIDGAYMEFAKFKSSKKEIDPKTLIQTFSNALYLGTFSKAYGLGGMRVG 238
gi 157738338 157 FLCIPNNPLGECLDKNDVYEFLKTIDKNTLVVVDGAYQEYAAFKDEKKRICPKDLIDTFPNAIYLGTFSKAYSLGGMRVG 236
gi 154174754 159 FLCLPNNPLGECLDTKEVYEFLKRIDEDVLVVLDCAYNEFAKFKDARKGIESSEILK-FKNVIYLGTFSKAYGLGGMRVG 237
gi 32266111  160 FLCAPNNPLGECLDAAAIEQFIQAVDKDTLVIVDGAYQEFAAYKDKAKAINPKQLIERFSNVIYLGTFSKVYGLGGMRVG 239
gi 152990139 157 HICTPNNPTGDALDAEYLYSFLDNV-QEPLVIVDGAYMEYAAFKDEKKRIHPQDLIKKYPNVIYLGTFSKAYGLGGMRVG 235
gi 78776672  157 FICTPNNPTGDALDAQKIYNFLEKIDNDTLVVVDAAYMEYAIVKDAKKEINVKELIQKHSNVIYLGTFSKAYGLGGMRVG 236
gi 152993633 157 YICTPNNPTGDATSREEVLKIIEGVDKDTLVVVDGAYMEYAAAKDQKHAIAPTDLLK-YENVIYLGTFSKAHGLGGMRVG 235
gi 34558287  157 FLCLPNNPLGECLDREEVYDFLQKIDDETLVIVDGAYQEYAAFKDSQKRIDPKDLIERFPSSIFLGTFSKAFGLGGMRVG 236
gi 45658350  161 FLCTPSNPAGDALSKSDVYEFLSKISLDTLVVIDAAYMEFGKKKDPNKFIPAKEVTDLFPNVFYTGTFSKVYGLGGMRIG 240
gi 24213881  161 FLCTPSNPAGDALSKSDVYEFLSKISLDTLVVIDAAYMEFGKKKDPNKFIPAKEVTDLFPNVFYTGTFSKVYGLGGMRIG 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118474105 239 YGIANEEIIKALHRLRAPFNITTLSLAAAIEALKDNDFLKETLENNFKEMKVYEEFAKENSIEFIESYTNFITFIFDQH- 317
gi 157738338 237 YGFAQNEIIQNLYKIRAPFNITTLSLAAAIEALKDEEFVNDCISKNFEEMKRYEEYVTKKGFEYIPSYTNFITIKFGDK- 315
gi 154174754 238 YGIAKESIISELCKLRAPFNITTLSLKAAIEALKDEEFVTKTLENNLKQMARYEAFAREADIEFIPSYTNFITFKFDK-- 315
gi 32266111  240 YGIASEHIISMLYKVRPPFNVTTLSLQAALIALKDQVFVSECIKNNAIEMARYEAFANEMGFTFIPSYGNFITFLHSH-- 317
gi 152990139 236 YGIADQSVIGQLYKLRPPFNITTLSLKAATTALEDEGFVQYSIEQNFLQMERFVNFALQNGFEFIDSYTNFITYLLPEN- 314
gi 78776672  237 YGISEAKIIKELYKLRPPFNITTLSLEAATVALSDEEFVQKSTALNLEQMKRYEEFAKEQKIDIINSYTNFVTLSLGSN- 315
gi 152993633 236 YGIAQAKLIKELYKMRPPFNITTLSLLVAIEACKDDSFVEASIALHQEQIKRYETFAKENGISYIESYTNFITYLFDEN- 314
gi 34558287  237 YGIAQPSIIQALMKMRAPFNITTLSLKAAIEALKESAYVEETIKENFKEMRRYEEFALAQGIDFIPSYTNFITLLLKNR- 315
gi 45658350  241 YGIGNQELISNLYKMRPPFSVTNLSALAATEALKNESYVESYLENNWNEMKRYEKFAAEQSIEFIDSYANFITFFARKRg 320
gi 24213881  241 YGIGNQELISNLYKMRPPFSVTNLSALAATEALKNESYVESYLENNWNEMKRYEKFAAEQSIEFIDSYANFITFFARKRg 320
                        330       340       350       360
                 ....*....|....*....|....*....|....*....|....*....
gi 118474105 318 QNATKICDNLLKQGIILRNLKSYSMNAIRITIGKNEQNRRVLDMLKKEI 366
gi 157738338 316 YVSKEVAQKLLERGMIVRDLTSYKQNAIRVTIGKPEQNTKLFQLLDEVL 364
gi 154174754 316 QSASEISQNMLKKGIILRDLKSYKLNAFRITIGQSWQNDRVFEELKQNL 364
gi 32266111  318 IESSHLCDWLLQNGLIVRNLRSYGLNAFRITIGRAEQNTRVFELIKAYL 366
gi 152990139 315 RKSKSLSEALLKRGVIVRDLTGYGMNALRITVGTKEQNDRFFEIFKEVL 363
gi 78776672  316 QNSTKIASQLLQNGMIVRDLSSYNMNAIRVTIGTQEQNSRFFKLVIKFL 364
gi 152993633 315 LDSTQISDALLKRGVIIRNLASYGMNGVRITIGTEVQNDVFFRHFAEVI 363
gi 34558287  316 VDSSEFSQWLLERGLIVRNLKSYGINAIRITIGRSLENDRCFELMQEYL 364
gi 45658350  321 KSSSEIAHSLLKQGIILRDLKNYDLNALRITIGRPEQNDLVLEALEKEF 369
gi 24213881  321 KSSSEIAHSLLKQGIILRDLKNYDLNALRITIGRPEQNDLVLEALEKEF 369
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap