Conserved Protein Domain Family
PRK03926

?
PRK03926: PRK03926 
mevalonate kinase; Provisional
Statistics
?
PSSM-Id: 179677
View PSSM: PRK03926
Aligned: 15 rows
Threshold Bit Score: 479.164
Threshold Setting Gi: 91774304
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
18978009    2 KVIASAPAKVILFGEHSVVYGKPAIAAAIDLRTFVEAELIrekkirieahdikvpgltvsfseNEIYFETDYGKAA---E 78 
294496197   1 MITCSAPAKVYLFGEHAVVYNESAICCAISIRTRVNIEYS-----------------------ENIVINSSLGTTGidyE 57 
73668945    1 MISCSAPGKIYLFGEHAVVYGETAIGCAIELRTHVRVELC-----------------------DSIIIQSEIGRTGidfE 57 
21227864    1 MVSCSAPGKIYLFGEHAVVYGETAIACAVELRTRVRAELN-----------------------DSITIQSQIGRTGldfE 57 
20089491    5 MISCSAPGKIYLFGEHAVVYGETAIGCAIELRTRVRVELC-----------------------DSIIIQSEIGRTGidfE 61 
91774304    1 MITCSAPGKVYLFGEHAVVYGEPAICCAVDIRTRVTVSPA-----------------------DTITISSSLGTTGidfE 57 
240103785   2 RVLASAPAKIILFGEHSVVYGKPAIAAAINLRTYVWAEFNergaikieakdirvpgltvsfseDEIYFESDYGKAA---E 78 
57641409    5 RVLASAPAKIILFGEHSVVYGKPAIAAAIDLRTYVSAEFNdtgaikieahdirtpglivsfteDSIYFESDYGKAA---E 81 
212223279   2 RVLASAPAKIILFGEHSVVYGKPAIAAAIDLRTYVWAEFNnkgaikieakdikvpgltvsfseDEIYFESDYGKAA---E 78 
298674294   1 MITSSAPGKIYLFGEHAVVYGENAICCAIELRTHVQAEFN-----------------------DHIEINSVLGRSGlnfE 57 
18978009   79 VLSYVREAINLVLEEADKKnvGIKVSITSQIPVGAGLGSSAAVAVATIGAVSKLLGLELSKEEIAKMGHKTELLVQGASS 158
294496197  58 IHPYVSAVVEKIRKKSPYR--GVSISIESDIPVGSGLGSSAAVVVATICAFNNLLKLGMDKESIASLGHSIEKEIQGSAS 135
73668945   58 KHPYISAAIEKMREIVPID--GVHLKVNSEIPVGSGLSSSAAVTIASIGALNKMFGCGLSLEEIAKMGHEIEIQVQGTAS 135
21227864   58 KHPYVSAVIEKMRKSIPIN--GVFLTVDSDIPVGSGLGSSAAVTIASIGALNELFGFGLSLQEIAKLGHEIEIKVQGAAS 135
20089491   62 KHPYISAVVEKMSEIVPID--GVHLKVNSEIPVGSGLSSSAAVTIASIGALNKMFGCGLSLEEIAKMGHEIEIQVQGAAS 139
91774304   58 VHPYVSAVLERFQDISSFD--GVDLRISSDIPVGSGLGSSAAVTVATIKAMDTLLDLGLELDDIAKMGHEVEQNIQGTAS 135
240103785  79 VLSYVRQAIELVREEADKNgrGITVSITSQIPVGAGLGSSAAVAVATIGAVSRLLGLELTNEEIGKLGHRVELLVQGASS 158
57641409   82 VLGYVRQAIELVREEADVNgkGITVSITSQIPVGAGLGSSAAVAVATIGAVSRLLGLELSNEEVGKLGHKVELLVQGASS 161
212223279  79 VLSYVRQAIELVREEADKNgnGVTVSITSQIPVGAGLGSSAAVAVATIGAVSRLLGLELSNEEIAKLGHKVELLVQGASS 158
298674294  58 KHPYVSAAIERMKEFAPVD--GVKININSELPVGSGLGSSAALTVSTIQALNHLFHCGLSLEQIADLGYNVEWDVQGNAS 135
18978009  159 GIDPTVSAIGGFIFYEKGKfeHLPFMELPIVVGYTGSSGPTKELVAMVRKRYEEMPELIVPILEAMGKVVEKAKDVILSN 238
294496197 136 AADTYVSTMGGTISIPMRQ--HLKNPRCNLVIGNTNVFSSTGQLVAKVASLKTIYPEVITPILSTIGKASLRGESLLENE 213
73668945  136 PTDTYVSTFGGIVTIPDRR--TLKTPDCGIVIGDTGVFASTKELVTNVRKLRESYPHLIEPLMVVIGRISKTAEPFFQTG 213
21227864  136 PTDTYVSTFGGVVTIPERR--KLKTPDCGIVIGDTGVFSSTKELVANVRQLRESYPDLIEPLMTSIGKISRIGEQLVLSG 213
20089491  140 PTDTYVSTFGGVVTIPDRK--KLKTPDCGIVIGDTGVFASTKELVANVRKLRESYPHLIEPLMIVIGGISKTAEPFFQTG 217
91774304  136 PTDTYVCTMGGVVLIPQRK--KLELIDCGILIGNTNIFSSTKELVGNVADLNERFPDVVGPVLSSIGKLSVIGEGLVNDR 213
240103785 159 GIDPTVSAIGGFIHYEKGKfePLPFMELPIVVGYTGSSGSTKELVAMVRRTREEMPEIIEPILLSMGKVVEKAKEILLSD 238
57641409  162 GIDPTVSAIGGFIHYQKGKfeHLPFMELPLVVGYTGSSGSTKELVAMVRKNYEEMPEIFEPILNSMGRLVEKAREVITSD 241
212223279 159 GIDPTVSAIGGFLHYEKGNfeHLPFMELPIVVGYTGSSGSTKELVAMVRRNYEEMPEVIEPILVSMGKIVEKAKDVLLSE 238
298674294 136 PTDTYVSTMGGVFMLPSRR--KLELNDCGIVIGDTKKNSSTKKLVTNVAELKNRFPEIVTSILSTIGKITYCGEYSVCNG 213
18978009  239 vdkeeKFERLGVLMNINHGLLDALGVSTKKLSELVYAARVAGALGAKITGAGGGGCMYALA-PNKQREVATAIRIAGGTP 317
294496197 214 -----DYRALGELMDVNQGLLEAIGVSCNELSRLIHSSRAAGALGAKITGAGGGGCMVALVgNENIDAISRAIKNAGGVP 288
73668945  214 -----DYSSIGKLMNVNQGILDALGVNTFELSKLIYSSRGAGAFGAKSTGGGGGGCMVALTaPDKCTQVAEAISGSGGKA 288
21227864  214 -----DYASIGRLMNVNQGLLDALGVNILELSQLIYSARAAGAFGAKITGAGGGGCMVALTaPEKCNQVAEAVAGAGGKV 288
20089491  218 -----DYSSIGKLMNVNQGLLDALGVNTLELSKLIYSSRGAGAFGSKSTGGGGGGCMVALAaSDKCTQVAEAITGAGGKA 292
91774304  214 -----DYVSVGELMNIDQGLLDAIGVSCAELSSLIYAARESGAYGSKITGAGGGGCMVAISpRENVDSVAEAIGMAGGKV 288
240103785 239 leekiRFERLGKLMNINHGLLDALGVSTKKLSELVYAARTAGALGAKITGAGGGGCMYALA-PEKQSEVATAITIAGGTP 317
57641409  242 ldrelKFQTLGKLMNINHGLLDALGVSTKKLSELVYAARTAGALGAKITGAGGGGCMYALA-PGKQSEVATAITIAGGTP 320
212223279 239 ldnevRFVQLGRLMNINHGLLDALGVSTKKLSELVYAARTAGALGAKITGAGGGGCMYALA-PEKQSEVATAITIAGGTP 317
298674294 214 -----DYESIGKLMNINQGLLDSIGVGSLELSQLIYSARSKGAYGAKLTGAGGGGCMIALAdASKTVDVSDAIKSAGGVP 288
18978009  318 MITEISREGLKIEEVI 333
294496197 289 IVTGVTDSGVRVDFDN 304
73668945  289 IITKPTEQGLRLE--- 301
21227864  289 TITKPTEQGLKVD--- 301
20089491  293 IVTKPTEQGLRLE--- 305
91774304  289 VVANATDIGVRVECQ- 303
240103785 318 MITEISKEGLRIEEVI 333
57641409  321 MITKISREGMRIEEVE 336
212223279 318 MITKISDEGLRIEEVL 333
298674294 289 ITTNITDKGVVVETKR 304
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap