Conserved Protein Domain Family
PRK03918

?
PRK03918: PRK03918 
chromosome segregation protein; Provisional
Statistics
?
PSSM-Id: 235175
View PSSM: PRK03918
Aligned: 10 rows
Threshold Bit Score: 681.019
Threshold Setting Gi: 296109493
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11498637    2 ILLKELQIKNFRSHSDSKIEFDTGINLIAGRNGAGKSSILEAILVAFY----GLKPATLRKNDLVRVNSS-GYSLSLTFS 76
gi 284161186   1 MLIKYVEIENFKSHRSSRVEFDRGVNLIVGRNGAGKTSILEAIAVALYgvkhGVKPSGVKKDDLIRDSAS-RYEIRLGFD 79
gi 18977539    1 MKLERVTVKNFRSHSDTVVEFKEGINLIIGQNGSGKSSLLDAILVGLYw---pLRIKDIKKDEFTKVGAR-DTYIDLIFE 76
gi 14521425    1 MKIEEVKVYNFRSHEETVVRFRKGINLIIGQNGSGKSSLLDAILVGLYws-kKLRLRGLKKDEFRRIGGKgGTRIEIKFE 79
gi 14590782    1 MKIERVIVQNFRSHKNSEIEFKPGINLIIGQNGAGKSSLLDAILVGLYws-kRMRLRGLKKDEFTRTGTR-GAIIEITFE 78
gi 242398089   9 MRIRSLKIKNFRAHENSHVEFNDGINLIIGQNGSGKSSILEAVFASLYlg-hGSFPRGYKKVN-TRIGKS-GFELVLKFE 85
gi 240103799   1 MRVRKIEIRNFRAHRKSIVEFSDGINLIIGQNGAGKSSILEAIFASLYlg-hPSFPKGYLKAN-ARVGTG-ELSLGLEFE 77
gi 57642146    1 MKIEKLIIKDFRSHALTKVNFSSGINLIIGQNGSGKSSILDALLVGLYw---pSKPKDLKKDDFERINGS-GTEITVFFE 76
gi 212224573   1 MKIEKLIIKDFRSHKLTKVTFTSGINLIIGQNGSGKSSLLDALLIGLYw---pSKPKDLKKDDFLRIGGT-TTEITVFFE 76
gi 296109493   1 MKIEELKIINFRSHKSSVLEFTDGINLIVGPNGSGKSSILEAILVGLYwd-kPRN----KIKDFHRDGKK--AEIEMKLK 73
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11498637   77 LNGDDYTISRKSN------GESILTGKEI-------VEGDSNITEWVERhLCPAHVFTGAIYVRQGEIDSIIRDDESRER 143
gi 284161186  80 FNGRDCLIVRSSD------GNSYLRCDKL-------LEGDERIREWVERnVAPSHVWLNAIYVRQGEIDEIVKDDERREK 146
gi 18977539   77 KDGTKYRITRRFLkgyssgEIHAMKRLVGnewkhvtEPSSKAISAFMEK-LIPYNIFLNAIYIRQGQIDAILESDEAREK 155
gi 14521425   80 NDDSKYVLFRDFSr-----NVAYLKVQENgkwrhasEPSMESVSSYIER-ILPYNVFLNAIYIRQGQIDAILESDETRDK 153
gi 14590782   79 EDGTKYKVLRDFAr-----NVSYLKRLDGrewrhvtETSMESVSSFIDR-IIPYNVFLNAIYVRQGQIDAILESDETRDK 152
gi 242398089  86 HNGKNYEIVRKSN------GESYLKENGGv-----lHEKDSDIARWSERyLYPLHVFRNALYIRQGEIENILVDEDVREK 154
gi 240103799  78 HNGKTYRITRTTKkselleNGKLI------------AEKSSEVARWVERnVYPLQVYTNALYIRQGEIEGIITNREVMEK 145
gi 57642146   77 KGNVKYQIHRNIGr-----GLAFVKYHDGssw-ktlETGQKPVRDWMEK-LVPYDVFLNAIYIRQGEIDAILESDESREK 149
gi 212224573  77 KDGVKYQIHRNITr-----GLSFVKYHDGssw-rglESGQKQVRDWMEK-LVPYDVFLNAIYIRQGEIDAILESDESREK 149
gi 296109493  74 LNNRSCKLLRSFPr-----NTAYLRYSDSyl---neRDGHRKTTEEIES-FIPYEIFLGAIYIRQGEINKLIESDEEREK 144
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11498637  144 IIRQITRIEDYENAWKNLGAVIRMLEREKERLKEFLSQEEQIKRQKEEKKAEIERISEEIKSIESLREKLSEEVRNLESR 223
gi 284161186 147 IIKRITQIEDYERAWENLGKVIKHFKEEKSRLEKEIKAESDVENRIKEVKEELEAKKRELDKKMIELRDVEEKLAEAEAE 226
gi 18977539  156 VVREVLNLDKFETAYKKLSELKKTINNRIKEYRDILARTENIEELIKENEQELIQVLQEISKIEEVLPSKRSKVDMLRKE 235
gi 14521425  154 VVREILNLDKLESAYENLKRIKTNINLLIESKKSFIARTENIEELIKANEDELTKKLSEINEISSKLPPIRGELEKVREN 233
gi 14590782  153 IVKEILNLDKLEKAYDNLGKIRKYIKYSIEEKEKFIMKTENIEDLIRTQEKSFTEVLNEIRNISSNLPRLRRELEGIKEE 232
gi 242398089 155 VLRKVLGIEDFENSANNAQEVLRELRKKREYLEKLIQASGDIQNKIKEQEKRLGEVIHKINELRKKEIETAEKLSAVSKR 234
gi 240103799 146 VLRKVLGIEDYENAERNSAEVIRELKRRRENLKKLIERKAEVEDRLSEAGKRFAETLRRISELRKRERELSAEVEKLSKL 225
gi 57642146  150 VVRQVLGLDRYENSYKNLLDVRKEIDARIKAIEDYLKSTENIDELIGNLEKELTSVLREINEISPKLPELRGELGGLEKE 229
gi 212224573 150 VVRQVLGLDRYENAYKNLLEVRKEIDARIRAIEDYLKSTENIDELIGNMEKELAETLKVINELSPEIPKLIKELEGVEKR 229
gi 296109493 145 VVKQILGLDKYEKADERLKNIKKLINFKMDNIEKFLSREEEIKKRLKEKEEKKEEIEKRVKLLNDEIRQLEEEREKVRRE 224
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11498637  224 LKELEEHKSRLESLRKQESSVLQEVRGLEEKLRELEKQLKEVVERIEDLEKKAKEVKELKPKAERYSILEKLLSEINQAL 303
gi 284161186 227 KERVEKLREKFEELNREKESIEKHAGKIEERIRGLRERRNGLKKEIEELKSRVRRLEEIRGYAEKYIELREEYEKTLKVE 306
gi 18977539  236 VLRLEETKVEIENSERLLEKRRGDKRTLEERIKNTEEYLEKLKEKEKELEEQVKEITSIKKDVDAYLALKEFKNEYLDKK 315
gi 14521425  234 VKELESIKGKISELKIQVEKLKGRKKGLEEKIVQIERSIEEKKAKISELEEIVKDIPKLQEKEKEYRKLKGFRDEYESKL 313
gi 14590782  233 VKTLEATFNSITELKLRLGELNGKKGRLEERIRQLESGIEEKRKKSKELEEVVKELPELEKKETEYRRLIEFKDEYLVKK 312
gi 242398089 235 YEELKEIKEILTQKEKEKLSVEGSMKKLEADIKNTRDRIAELEKELRVLRDKEGRLKEIEWVKKEYETLNALMVK-RKEL 313
gi 240103799 226 YQEMKERKELIAGLEKRIALLEKSLASEEELLKEREKRIEELKLELEELEEKRARLEELKPLAEEYIELGKLL-KLKDEL 304
gi 57642146  230 LKELEKTAEELAKARVELKSEEGNLRELEAKKSGIQSMIRETEKRVEELKEKVKELESLEEKAKEYERLSRFYRNFTEGI 309
gi 212224573 230 LRDLDALAEEINALQLETRKREGNVKALEAKLQELEKRIEESRSHLRELEEKVRESNKLKGSAELYLKLVEFRKQYVDEK 309
gi 296109493 225 KEKYDKLREEINEKKEKNLKLEKEIEALKIKLGEIEERIKEKEEEIKKLEKNIERVKEIEEEALTYVKISKFYEDYKERS 304
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11498637  304 RDVEKREGDLTREAAGIQAQLKKAEEDNSKLEEITKRIEELERELERFEKSHRLLETLKPKMDRMQGIKAkleeKNLTPD 383
gi 284161186 307 RELKETLARLESERNGVIRLLSDLENKKKRLNELKGKLEEVEKRKSEIEGKALKYEEIKVKLERLRELEK----TCRPLE 382
gi 18977539  316 YKIEKELTRVEELINEIQKRIEELNEKESEKEKLENEKKEILNKLAILEKDHQLYEEIKAKKENLRQLKEk--lGDKSPE 393
gi 14521425  314 RRLEKELSKWESELKAIEEVIKEGEKKKERAEEIREKLSEIEKRLEELKPYVEELEDAKQVQKQIERLKAr--lKGLSPG 391
gi 14590782  313 NELEKRLGILSNRLQEVKRKIKDAESKVARIRWIEERLKEIQEKIMKLEPRVREFEDAMRLKAQMESLKSk--lGGLEPE 390
gi 242398089 314 QEIELRKSRLEERIKVLQKQIQELESKSEELEETKKLEKKLLDDYNVLKTFAETYDMVRQLVVEKEKYSTelekAGYTKE 393
gi 240103799 305 SNVEVGLSSLREKLRSLEREMEKREELERKLGELKKKEVETRREYERLKERHKLYQRALSILGEAEKHRKelerAGYTVE 384
gi 57642146  310 NRIEKLLATYSQQAENLRERIDELSKKEARVKELLKEKEGLQKELGALEEDLKAYQRAKELMANLERLKKrltlSEEEIE 389
gi 212224573 310 ANGEKLAENYRAQISGIEERLAELSDMKNRIGELEKKREELKKKLAELEESVKAYEEARALKTNLDRLRKrlkfEPEEIE 389
gi 296109493 305 YKISKELEKYSQLIEGVEEKLSEISSKEEEVKKLSEEFKELKRRVEELKEWEELFNKVRAKENELNNIKKr--iTINNIE 382
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11498637  384 KVEKMYDLLSKAKEEekeITEKLKKLIAKKSSLKTRGAQLKKAVEELKSAERTCPVCGRELDEEHRKNIMAEYTREMKRI 463
gi 284161186 383 EIERELEEVERAKLKlkdVEKDERNLLDMKARLESEIERLKEALNALKSAKGVCPTCGRLLSEDDRLNLIKSYTKKLENV 462
gi 18977539  394 DIKKLLEELETKKTT---IEEERNEITQRIGELKNKIGDLKTAIEELKKAKGKCPVCGRELTDEHREELLSKYHLDLNNS 470
gi 14521425  392 EVIEKLESLEKERTE---IEEAIKEITTRIGQMEQEKNERMKAIEELRKAKGKCPVCGRELTEEHKKELMERYTLEIKKI 468
gi 14590782  391 KINEKLLYLENRKKE---LEEEIDKITRKIGELNQRSKDRRLAIIELKKARGKCPVCGRELTEEHKADLLRKYSLELSSI 467
gi 242398089 394 KLVNEIKNVEKAKKElkeVEDKILTLKGELNGLDKIEKSLRDNVSKLEGAK-ECPLCKRPIEEHEEGEIKREYTAELAKI 472
gi 240103799 385 KLEKELKEIEKAKEElerLREEISKVRERIASLRGKRAELEANMERLEGAK-ICPLCRRPIDEHEEGEILAEYRAEISRI 463
gi 57642146  390 KLEAEIQKARERKEE---IMKELEEIGSRRGELKSIAGERNKALMELKKAKGRCPVCGRELTEEHRKELLEKYTAELKEI 466
gi 212224573 390 RLAAEIEAAKKRKEE---IQRELEEINEKRGELKNRVSERNKAIIELKKAKGKCPVCNRELTEEHRKGLMERYLAEVKDV 466
gi 296109493 383 EAKRKLEEAKKRKEE---VTLEISKLEAEIRNIEKEIKEKKKAINELKEAKGKCPVCGAELTEEHKERLINEYKEEIKDL 459
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11498637  464 AEELAKADEIEKKLKERLEKVEKALEKQETVLKYRQMVDELKALENELSSHdaEKLSAESEEYRKVKERLDGLRGQQKIL 543
gi 284161186 463 RKDLIEIENKLEDIKNVKKELESVISEESRILREYELAKELENLKKSTKGF--EEAEAAWKEYRKLEELALKLSADISVI 540
gi 18977539  471 KNTLAKLIDRKSELERELRRIDMEI---KRLTPLLTVAEQIRSIEEELNVVnlEKIEKNATEYEKLLEELRTLEGRIRGL 547
gi 14521425  469 EEELKRTTEEERKLRVNLRKLEIKL---REFSVMRDIAEQIKELESKLKGFnlEELEQKEREFEGLNEEFNKLKGELLGL 545
gi 14590782  468 EKEIQEAKALERQLRAEFRKVENEL---SRLSSLKTIADQIIEIRERLSKInlEDLKRDKEEYELLKSESNKLKGEVESL 544
gi 242398089 473 EKKKEEIAEALRKALKRKTELEKIRNNESKLIKLHKTLEFLENVESKLEKYniEELKKKTEEFEKVRERVIEVKKEIIRV 552
gi 240103799 464 ESEVKTFGEKLEELRKREVELRKLLAREPKLIRLKKTADLLREAEEKLEELgvEELERDAKLFEETKEKLIGLKKEIRNV 543
gi 57642146  467 SAEMKELEKREKKLRAELVEVEKTLKKERELFALKEVLEQIRETEEKLKEYdlEKLEEANEKAEELKKKLAGLEGEIKSL 546
gi 212224573 467 SKEIKELDSQERKLRRELVKVEGVLKGERELITQRELLEQIKELEEKLKSYdlKKLEKKAEDYENLKGKLGKIEGELKSL 546
gi 296109493 460 LKRKKEIEEKISELKKEAKNIETFLLKEPEIRKNESLYDQLKSLEEELGKInkEEVEEKYRELETLKRKSIEIGSKISTL 539
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11498637  544 LSSASRIKELKSSLREIEEALKNVESERGELHRKireegfesleeLEREVQSLRPFYNKWLELKDAESRLESELKRREKL 623
gi 284161186 541 ESDLKSEQELNSKLIELNSKIDEVEEKLSNLKKI-----------DESTLKELESYYNEFNRLVSAKHDLERKLEELKSC 609
gi 18977539  548 AEDLKKLAPLEKKLAALIHKKQELEKELKELNTKlesfgfksvedLDSKLRELEEIYKRYLTLLNSKKELEITQREIAKA 627
gi 14521425  546 ERDLKRIKALEGRRKLIEEKVRKAKEELENLHRQlrelgfesveeLNLRIQELEEFHDKYVEAKKSESELRELKNKLEKE 625
gi 14590782  545 KKEVNELNDYKNESTKLEIEIDKAKKELSEIEDRllrlgfktideLSGRIRELEKFHNKYIEAKNAEKELRDILESLKDE 624
gi 242398089 553 NKELEKLNEFKNEKETLLRKLGDLERKKAEVLHEieekgfesfedVEKRLKELEPLYKEYISLSNVPQEIQIREKRQELL 632
gi 240103799 544 KERLEELEGLEKEKRAVEKELHTLEERKADILKRlsergfssfdeVEERIGELEKPYREFLSLKDIPRRIEALEKKLDIE 623
gi 57642146  547 EDEIKKGELLKKKLALVEKKLRELEEERASLLGElkklgfgdvkeLEERLKELEPAYKRYIELRPARDELKREEDLLKSL 626
gi 212224573 547 KDELEKAKALEKKKAVLEKKLKSIEEKLAELENElgelgfsdikeLDEKLSELEPAYRRYLELKGAESELEREKKRLKRT 626
gi 296109493 540 KKEIERKEELIKRLEELKNKKEEKEEELKKLIKElenlgfsceeeVKEEIERLKPIYEEYIKLKDSVKEKEEKEEEIKKL 619
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11498637  624 EDEISEAIAKLEEANGKAEEIRGQIDELLriYSEEEHRRLSDEHLRKSKELAGLKSRLETLRESLQSAEKDLKFLEEQLA 703
gi 284161186 610 ESEIVKAEDELSETLKRLESLKNEIEALG--YSDETYRNVYNLYTELRSRYFGLREGVERLKDHIKTLEKSAEDLENRVK 687
gi 18977539  628 KETLEMSFEELAEVEADIERIEKKLSQLKqkYNEEEYKKKREEKEELEKELARLEAQKKELEKRRDTIKSTLEKLKAEKE 707
gi 14521425  626 KTELDQAFEMLADVENEIEEKEAKLKDLEskFNEEEYEEKRERLVKLEREVSSLTARLEELKKSVEQIKATLRKLKEEKE 705
gi 14590782  625 REELDKAFEELAKIETDIEKVTSQLNELQrkFDQKKYEEKREKMMKLSMEIKGLETKLEELERRRDEIKSTIEKLKEERK 704
gi 242398089 633 ETTLKDKEKDLNLTKNVFKMLSKEIEELKvrFTVEEFEKISKEYLSLSSLHAAVLKEIEGNENLKEEVARNLEDLKRQLE 712
gi 240103799 624 QRKADESRANIARLKAELEKARKELEEARkeFSEEDFERAEREYLEKSRALERARAELEGAESLRDEIARLIDELKANLG 703
gi 57642146  627 KLDLTAILKEIEKTSKRVEELRKRVEELEksYDKDRHEELKGKTRELSNELAGLEARLKSLEERRDEVKASLEKLREEKE 706
gi 212224573 627 EEELEETREKLQGEFSSLEELRKRLNEKEklYSPEEHAGIRERFTSLREELAGKRAQLEALEKKREETMENLKKLKEEKE 706
gi 296109493 620 ANEVEKISKYIDVKDKALRELKERLEELNknYSEEEHKNLENKFLELEREYSRKDEEFKQLNSQLEEIIKDLDNLKRDLD 699
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11498637  704 KMDEYRKKVEVFEKiAIPELTRIREKFRKYRNLVAENSMREVERYASQIFEELTEGKYSGVRLKKTtergKEKLKVFVVY 783
gi 284161186 688 KLREKRERVEKIGReVLPKLEEIREKFRKYKVSLTEYAFKEVEKIASEIFEEMTDGKYSGIVLKREek-rKEKVTVKVLY 766
gi 18977539  708 NRERVKKEIKDLEK-AKDFTEELIEKVKKYKALAREAALSKIGELASEIFAEFTEGKYSEVVVRAE----ENKVRLFVVW 782
gi 14521425  706 EREKAKLEIKKLEK-ALSKVEDLRKKIKDYKTLAKEQALNRISEIASEIFSEFTDGKYSNVIVRAE----ENKTKLFVVY 780
gi 14590782  705 ERESAKMELEKLNI-AIKRIEELRGKIKEYKALIKEEALNKIGEIASEIFSEFTDGKYSGIAIRAE----DNKVKLFVIY 779
gi 242398089 713 AIKKAKEESELIEK-MMADMKVLREKLLKLKAEAERRGLSEVERVASELFSDMTERKYQGIKIIREkkfgRERIRIVVLY 791
gi 240103799 704 EIEKAERELELIEK-ALADLTAFREKIARLKAEEELRGLEEVQKLAGELFSEMTEGKYQGIRLRREkrygKERIELKVLY 782
gi 57642146  707 TRKEKAKELEKLKK-ARERVQRLREKVKAYKNLLKEGALAKVGEMASEIFEELTEEKYSGVTVKAE----ENKVRLGVVY 781
gi 212224573 707 ERKEKIKELENLKK-ARERVQNLREKVRRYKAMLKEGALAKVGELASEIFEELTEEKYSGVTVKAE----ENKVKLGVIY 781
gi 296109493 700 EISKYREEIKSLEK-ALEFVEELRKKVKEFKNKLKCHAFQKVSEIASEIFEELTEEKYSGVAIKEK----GNKLIVNIIY 774
                        810       820       830       840       850       860       870       880
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11498637  784 QGEEREIGFLSGGEIIALGLAFRLALSMFMIrGKIPLLILDEPTPFLDEERRRKLVDITTNYLRKIPQVIIVSHDEELKD 863
gi 284161186 767 QGAERDISFLSGGELIALGLAFRLALSVFMIqGKIPLLILDEPTPFLDDERRRKLVDIMNRYLKKIPQVIVVTHDEELRD 846
gi 18977539  783 EGKERPLTFLSGGERIALGLAFRLAMSLYLA-GEISLLILDEPTPYLDEERRRKLITIMERYLKKIPQVILVSHDEELKD 861
gi 14521425  781 EGKEVPLTFLSGGERIALGLAFRLALSMYLV-GRIDLLILDEPTPFLDEERRRKLLDIMERHLRRISQVIMVSHDEELKD 859
gi 14590782  780 DGVERPLTFLSGGERIALGLAFRLAMSMYLI-GKVDLLILDEPTPFLDEERRRKLIEIMERHLRKISQVIIVSHDEELKD 858
gi 242398089 792 QGQEEEIDFLSGGERIALGLSFRLALSLYKV-KNMELLILDEPTPFLDEERRKKLVEIITQHLRKIPQVIIVSHDEELKD 870
gi 240103799 783 AGNEVGIDFLSGGERIALGLAFRLALSLYKV-GNLELLILDEPTPFLDEERRKKLVEIISSQLRKIPQVIIVSHDEELKD 861
gi 57642146  782 NGKEYGLGFLSGGERIALGLAFRLALSLYLA-GEISLLILDEPTPYLDEERRRRLVDIMQRYLRKIPQVIVVSHDEELKD 860
gi 212224573 782 NGKEYGLGFLSGGERIALGLAFRLALSLYLA-GEISLLILDEPTPYLDDERRRRLVDIMQRYLRKIPQVIVVSHDEELKD 860
gi 296109493 775 EGKERNLNFLSGGEKVALGLAFRLALSLYLA-GNIPLLIMDEPTPYLDEERRRRLVDIIERYLKRIPQVIIVSHDEELKD 853
                        890       900
                 ....*....|....*....|..
gi 11498637  864 AADKVIFVESQGGVSRVRYVEA 885
gi 284161186 847 VADKVIRVELHGGVSKVMEGFE 868
gi 18977539  862 AADHVIRISLENGSSKVEVVS- 882
gi 14521425  860 AADYVIRLRLEGGKSKVEVVS- 880
gi 14590782  859 AADHVIRIRLEGGASKVEVVS- 879
gi 242398089 871 AADYVIRVSLIGGKSNVEVESL 892
gi 240103799 862 AADYVIRVT-NAGEARVEVESL 882
gi 57642146  861 AADRVIRVSLENGVSVVREAEV 882
gi 212224573 861 AADRVIRVSLENGVSSVREVEL 882
gi 296109493 854 AADRVIRVSLNNGVSKVEVE-- 873
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap