Conserved Protein Domain Family
PRK03817

?
PRK03817: PRK03817 
galactokinase; Provisional
Statistics
?
PSSM-Id: 235163
View PSSM: PRK03817
Aligned: 17 rows
Threshold Bit Score: 524.946
Threshold Setting Gi: 302348587
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
217077642   1 MKVKAPGRVNLIGEHTDYNDGFVLPFAIDRYVELEIEES--DKFCFYSNNLNE--EVKLSSLQKTNSWADYIVGVIKEIE 76 
157363966   2 TKFRSPGRVNIIGEHTDYNNGFVLPFAIDKYIEVDVSSS--NEFVFVSHTMNE--TVGLKKYEKLGKWTDYLMGVIWAIE 77 
148270685   1 MKVKAPGRINIIGEHTDYNDGYVLPFAVNRYVFLSIEGS--DRFIFHSENVNE--TVEMEKIEKLNKWTDYISGVIASFE 76 
281412991   1 MKVKAPGRINIIGEHTDYNDGYVLPFAVNRYVFLSIEGS--DRFIFHSENVNE--TVEMEKIEKLNKWTDYISGVIASFE 76 
170289409   1 MKVKAPGRINIIGEHTDYNDGYVLPFAVNRYVFLSIEGS--DRFIFHSENVNE--TVEMEKIEKLNKWTDYISGVIASFE 76 
15643946    1 MKVKAPGRINIIGEHTDYNDGYVLPFAVNRYVFLSIEGS--ERFIFHSENVNE--TVEMEKIEKLNKWTDYISGVIASFE 76 
222100359   1 MRVKAPGRINIIGEHTDYNDGYVLPFAVNRFVFLTIEDS--GKFVFHSENMNE--TVEMEKIEKLNRWTDYISGVIKAFE 76 
150020324   1 -MYRAPGRINIIGEHTDYNDGFVLPFAIDKYITLHIEKS--KKFIFKSKNSTQ--EIQLDKLEKTNTWADYIVGVIFEIE 75 
302348587  13 ITVRSPGRVNIIGEHTDYALGYVMPMAIQLGTTFTAEPSldERTCIFSEAMKEelCFG-DELVREGRWIDYVKGVYYAIR 91 
257054079   8 YTVRSPGRVNLIGGHTDYTLGYVMPLATDLQTRLEATES--EDVHVSSTAVESsySFATDDLEPVEDWVDYVKGCYAILQ 85 
217077642  77 KRGYKIQPVKIKVDSNIPIGAGLSSSAALEVASAYAISEYFGLNLSKIDIVKISREAEANFVGVNCGIMDQFASAFSKKD 156
157363966  78 KSGCEVKPVRIDVSSTLPLGAGLSSSAALETAVAYGLNSVMNLNLSKKQIVDVCVRAEREFVGVQCGIMDQFTVVFGKKD 157
148270685  77 KRGYRVSPVKISVSSNLPMGAGLSSSAALEVATAYAISEYFSFNVPKLELVKIAREAEVEFVGVRCGIMDQFTSAFGKKD 156
281412991  77 KRGYRVSPVKISVSSNLPMGAGLSSSAALEVATAYAISEYFSFNVPKLELVKIAREAEVEFVGVRCGIMDQFTSAFGKKD 156
170289409  77 KRGYRVSPVKISVSSNLPMGAGLSSSAALEVATAYAISEYFSFNVPKLELVKIAREAEVEFVGVRCGIMDQFTSAFGKKD 156
15643946   77 KRGYRVSPVKISVSSNLPIGAGLSSSAALEVATAYAISEYFGFNVPKLELVKIAREAEVEFVGVRCGIMDQFTAVFGKKD 156
222100359  77 KRGYKVSPVKISVSSNLPMGAGLSSSAALEMATAYAISEHFGFHLPKLELVKIAREAEVEFVGVRCGIMDQFTSAFGKKD 156
150020324  76 KNHGKVSPFKFFINSNLPIGAGLSSSAALEVVSAYAINDQLNLNLSLEVIALIGWKAENNFVGLNCGIMDQYAVAMSKKN 155
302348587  92 SRGLRYMHVSGRLSGDLPMSSGLSSSASLEMAIAVAQNELARLGLSRLELARLGVTAENEFLGIPSGILDQFAAVMGKEG 171
257054079  86 AAGYDPGGFRGDITTKLPIGAGLSSSASLELAVMALLNEAYDLGLSRERMARLSQRVENDYVGVACGIMDQFAVALGQDG 165
217077642 157 YAIFLDTMTLDFQFVPLNlKGYEIFVIDSNVKHELSSSEYNLRRQECESALEIIGKDSFRNVTREDLKLLNgGTLLKRVQ 236
157363966 158 HAIFLDTFNLSYEYVPLNlGEYEFALIDSNTKHELSSSEYNKRREECERILKALHKNSFREITYEDLNQLE-PALRKRAR 236
148270685 157 HAIFLDTMTLEYEYVPLRlEGYEINLVDSNVKHELSSSEYNKRRQECEEVLKTLGKKSFREVTKEDLERLS-GTLRKRAQ 235
281412991 157 HAIFLDTMTLEYEYVPLRlEGYEINLVDSNVKHELSSSEYNKRRQECEEVLKTLGKKSFREVTKEDLERLS-GTLRKRAQ 235
170289409 157 HAIFLDTMTLEYEYVPLRlEGYEINLVDSNVKHELSSSEYNKRRQECEEVLKTLGKKSFREVTKEDLERLS-GTLRKRAQ 235
15643946  157 HAIFLDTMTLEYEYVPLKlEGYEINLVDSNVKHELSSSEYNRRRQECEEVLKTLEKKSFREVTKEDLERLS-GTLRKRAQ 235
222100359 157 HAIFLDTMTLEYEYVPLKlEGYEINLVDSNVKHELSSSEYNKRRQECEEVLRVLGKRSFREVTKEDLKKLP-DVLKKRAQ 235
150020324 156 HALFIDTYTKSYELIPLNlKDYSFYIINSGIKHELGNSEYNIRRNQCKEALKIIGKKTFREISYKDLSKLE-GVYFKRAK 234
302348587 172 KAVFTDTETLNYEYVPIP-EDVEFLVFHTGIRRAVAGTEYSERVKVVKSALRALGVSSSKYVREEQLSRLD-ELQRKRLG 249
257054079 166 HALSIDTETLTYTPVPFP-DGIEILVFHTGVSRGLVESAYNQRRETVEGALEKLDVDSSKDVSEGDLHGLD-PLERERLG 243
217077642 237 HILEENERVLKTVKALKENEIERIGEYLYQSHESLRYLYEVSCDETDFIVDFLKEKdGIIGARMVGGGFGGGVIVISKEG 316
157363966 237 HVLDENKRVNMAVRALKKSEMFLLGNLLYESHVSLRDLYEVSCEEIDFIVGFLRGRlGILGARIVGGGFGGSVLVFGRKG 316
148270685 236 HVLEENERVLKSVQALKEGDFETLGKLLFSSHESLRDLYEVSCEETDFIVDYLRGKeGILGARMVGGGFGGGVIVLSKKG 315
281412991 236 HVLEENERVLKSVQALKEGDFETLGKLLFSSHESLRDLYEVSCEETDFIVDYLRGKeGILGARMVGGGFGGGVIVLSKKG 315
170289409 236 HVLEENERVLKSVQALKEGDFETLGKLLFSSHESLRDLYEVSCEETDFIVDYLRGKeGILGARMVGGGFGGGVIVLSKKG 315
15643946  236 HVLEENERVLKSVQALKEGDFETLGKLLFSSHESLRDLYEVSCEETDFIVDYLRGKeGILGARMVGGGFGGGVIVLSKKG 315
222100359 236 HVLEENERVLKSVQALKEGDFETLGRLLFSSHESLRDLYEVSCEETDFIVDFLKGReGILGARMVGGGFGGGVIVLSKKG 315
150020324 235 HILDENKRVLNVIKSLKNNDIETVGNLLFESHESLKNLYEVSCEEIDFIVEFLKNK--VTGARIVGGGFGGSVLVLSKEN 312
302348587 250 YVIRENSRVLAVRDALRSGDVVTTGRILTEAHWDLARNYEVSVPELDFFVEFATSH-GAYGARLTGAGFGGAAIALVDRG 328
257054079 244 YVVRENARVQRAQAALEDGEIQTFGEILLSAHRDIADHYDASCKELDFVVETALEA-GAYGARLTGAGWGGAAIAVVDTE 322
217077642 317 SFESIEKLLENEYYSRFG-IRPTFYKLNSSDGVTK 350
157363966 317 CIEEAYHELRDRYYKMFG-ITPELIHIKSDCGVHA 350
148270685 316 AFGKIKEELVESYKKHFG-IDLTFHEIESSDGVQK 349
281412991 316 AFGKIKEELVESYKKHFG-IDLTFHEIESSDGVQK 349
170289409 316 AFGKIKEELVESYKKHFG-IDLTFHEIESSDGVQK 349
15643946  316 AFGKIKEELVESYRKRFG-IDLIFHEIESSDGVQK 349
222100359 316 AFEKIKEELKNAYRDRFK-IELTFHEIESADGVQK 349
150020324 313 VFENIIDILKYEYEKKFH-INLEYFKVESTNGVEK 346
302348587 329 KGEQLGREAEEEYVRRFP-HRPQHWVVTPAEGARV 362
257054079 323 TVESVATSIEAAYREQFPeHDPHYYRIEAADGVRV 357
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap