Conserved Protein Domain Family
rumB

?
PRK03522: rumB 
23S rRNA methyluridine methyltransferase; Reviewed
Links
?
Statistics
?
PSSM-Id: 235128
View PSSM: PRK03522
Aligned: 138 rows
Threshold Bit Score: 252.097
Threshold Setting Gi: 261868606
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 298346672   1 MVVSGSKKSIVLGLAPN---------EKHptgIDLQSCPLYAPAIHAAFTPIRAWLQRLGARPYNI-----------PTA 60
gi 239918636  63 LVVTGSAAAPRLGILDPrqhp-rhhdGAG---VDLRDCGLYEAGMEGVFEACAAAVTAAGLEPYDV-----------AAR 127
gi 220911913  61 MVISGTARNPTIGILDAe--------AHG---IDLRKCGVCSPGLRAVFPVVAAFIRTHRLTPYDV-----------PNR 118
gi 296129134  61 MVVAGTVEAPTLGILDGh--------GHG---VDLQGCPLYPPAVSAAFSPLADFVTRARLTPYDV-----------PTR 118
gi 119717975  65 MVVSGTLAEPTLGILNPa--------GAG---VDLRDCPLHTPGIQAALPVLADFVTRAALAPYDL-----------ATR 122
gi 297572301  84 LVVTGTANQPKLGILGA---------GGG---VDLRDCPLPSTGIRGAIPSIARFITACGLDPYSP-----------ATD 140
gi 152968262  61 MVVGGTVERPTFGILDAa--------GRG---VDLSECPVCAPGILDLLPVLARFTTRAGLVPYDV-----------PRR 118
gi 184201679  61 MVVAGRVGAPALGILDG---------AAG---VDLRDCPLYPEPVTRALHALADFIGRVRLLPYDV-----------AKR 117
gi 229819942  61 MVVTGSAVDPVIGILGPd--------GEG---VDLRWCGLHEPPVTAALSPLAEFVARANLAPYDL-----------RTR 118
gi 269958068  62 MVVTGTVEEPVIGIVGAlpqgydrvgHRGptgVDLTDCPLYPPTLQDAFGPLAELVTRARLQPYDLtpsrgrvtprdAAG 141
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 298346672  61 KGEVKYVLVSANP-AGDLMVRLVLRSKAALHRVEHTWSELQAELPN----LRVFSVNIQPEHTTVIEGREEIILSSERYI 135
gi 239918636 128 TGELKNVIVTLSPdRE-AMVRFVLRSADRLDALRAAVPGLLDDLAArgtpAAVVSANLLPEHVALPEGDKEIVLAGGPTL 206
gi 220911913 119 SGELKHLIVTESP-DGEIMLRLVLRSEQLVPRIRKHLPDLLEALPQ----VKVVSINLHPEHKAVLEGDREILLTEQSTL 193
gi 296129134 119 TGELKHVLVTGSP-DGELMVRFVLRSTEALARIRKHLPRLQTDLPH----LVVASVNVQPAHAAVLEGEREIPLTARETL 193
gi 119717975 123 RGELKYLLVTESP-DGELMVRFVLRSQEPVARIRKHLPALLERLPQ----VAVATVNLQPEHKAVLEGEREIVLTEQESL 197
gi 297572301 141 HGTLKYVIITESf-DGELMVRFVARRRGVQGILFKRRAELLREVPN----IRVVSLNVQPERKAIIEGEEEILITDHGVL 215
gi 152968262 119 RGELKNVLITESP-SGELMVRFVLRSQDRLPALRRHLPQLLREAPR----LAVVSVNLLPEHKAVVEGDVEIALTERTTL 193
gi 184201679 118 RGEIKHVIVTGSP-EGRLMVRFVLRSTRQLPKIAENLDLLRELVPA----ADVVSVNIQPEHKAVLEGPEEILLSEQSEL 192
gi 229819942 119 RGELKYLLVTASP-DGEVMVRFVLRSTEALARIRKHLPALQEALPR----LAVASVNVQPEHSAVLEGPTEIPLTPAQTL 193
gi 269958068 142 RGELKHLIVTVSP-AGALMVRLVLRSQEPVARLRKHLPWLQTALPN----LAVLSVNLQPEHKAVLEGEREIVLTERETL 216
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 298346672 136 PMPG----IGTDLWLAPGAFFQTNTAASQALYAQAATWARKL-QPETAWDLYCGVGGFAFALSS--AGvAQVTGVEVVGP 208
gi 239918636 207 TMRL----NGVGLRLRPQGFFQTNTAVTEGLYATAAAWVAEAgLPATAWDLYCGVGGFAFHLAR--AGvRDVWGMESSAE 280
gi 220911913 194 NMRV----NDINLHLRPQSFFQTNSHMAAALYRQGREWVNEL-APASVWDLYCGVGGFALHVAN--PS-RTVTGIETSSE 265
gi 296129134 194 RMHV----NGLDLHLRPRSFFQTNTEVAAALYRQALAWADEA-AVTSAWDLYCGVGGFALHLAR--AG-RQVVGVEASAE 265
gi 119717975 198 LMQV----GGLGLHLRPQSFFQTNTAMAAELYRLARAWTAEL-APGRVWDLYCGVGGFALAIASt-AH-AEVTGVEVSGE 270
gi 297572301 216 PMRLg---GELTLNVRPQSFFQTQTECAAHLYTTAAEWLEN---VDSAWDLYCGVGGFAMALAQlgNA-SKVIGVEVSEQ 288
gi 152968262 194 RMPM----GGVDLDLRPQSFFQTNTVVARELYAQVARWVDEV-APASLWDLYCGVGGFALHCAA--PG-RRVTGIEVSAE 265
gi 184201679 193 VMRL----NGIDLRVRPRSFFQTNTAVTEQLYRQVADWVDAV-GPASVWDLYCGVGGFALHVAG--PG-REVVGTEISEE 264
gi 229819942 194 RMAV----NGLDLHLRPQSFFQTNTAVAAALYREATDWIDEL-APSSVVDLYCGVGPFALHAAArdTE-RRVLGVETSAE 267
gi 269958068 217 PMTLpvrpGGLTLHLRPQSFFQTNTDVAAALYRQAAQWIDDV-APASLWDLYCGVGGFALTCAA--PG-RAVTGIEISAE 292
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 298346672 209 AIDGAKHAVTELasatatvpvepsnkndGT-PntpsaapRPHFITADAT--------KWAVNQt----LMPPDLVVVNPP 275
gi 239918636 281 AVAAARETAAEL----------------GLaD-------RARFSAGDATsalsfgkrRAPEALsfekrRARPDAVVVNPP 337
gi 220911913 266 AIVSARLSSDEA----------------GL-Q-------GMEFEAGDAT--------AFALAA-----RQAPDLVIVNPP 308
gi 296129134 266 AVVSAELTARDA----------------GL-P-------GTRFVAGDAT--------AFALDA-----TDVPDLVVVNPP 308
gi 119717975 271 AIASATASAREA----------------GL-D-------RVRFEAGDAT--------AWVSDR-----PDVPDLVVVNPP 313
gi 297572301 289 AVEAARVAARDL-------------------P-------GVAFVAADVS--------EWIAEQg----EERPGAVVVNPP 330
gi 152968262 266 AVESARAAAAGL-------------------P-------DVEFAAGDAT--------RFALEA-----PEAPELVVVNPP 306
gi 184201679 265 AVASAQDTARAM----------------GLpQdg---pgSVRFLADDAA--------ATPADL-----PGTPELAVVNPP 312
gi 229819942 268 AIASATHSAADA----------------GL-A-------NARFAVGDAT--------AFAADD-----DGVPDVVIVNPP 310
gi 269958068 293 AVASAQVTRAEL----------------EAtDggpaamaGVRFAAGDAT--------AFALGCd---pADVPELVIVNPP 345
                        330       340       350       360       370       380
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 298346672 276 RRGLGPDLSSWLERSGIPHLIYSSCFPGTLVEDLRRMRSYQIRAAKLVDMFPHTSHVECVVLMSRA 341
gi 239918636 338 RRGIGAELADALEDSGVPTVLYSSCNPATLAQDLARMPSYRVARVQVFDMFPQTRHAEVLTLLTRR 403
gi 220911913 309 RRGIGKELCGWLESSDVQHVVYSSCNAQSLARDLAALPSFTARRVRVLDMFPQTTHYEVMVLLERA 374
gi 296129134 309 RRGLGEPLSRWLEASGVPRVLYSSCHAGSLARDLAHMPSLRLVRAQVLDMFPHTAHHEVLTLLERS 374
gi 119717975 314 RRGLGPELSGWLEDSGVRHVLYSSCNAHTLARDLDAMPSLRPVRAQLLDMFPNTAHYEVLALLERL 379
gi 297572301 331 RRGISPELCAWLNESGPDYVLYSSCNAETLARDVAAMPAYRVERAQVVDMFPHTKHFETLVLLKR- 395
gi 152968262 307 RRGIGPELSGWLERSDVAHVVYSSCNPVTLAKDLAAMPSLRPVRARVLDMFPHTQHVEVAVLLSRT 372
gi 184201679 313 RRGLDASLCAWLESSSVRHAVYSSCNAQTLARDLARMPSLRPVEARLLDMFPHTGHYEVAVLLRRD 378
gi 229819942 311 RRGIGPDLAAWLERSGVRHVVYSSCSSASLARDLAVMPSLRPVRARVLDMFPQTAHYEVLTLLERG 376
gi 269958068 346 RRGIGPALADWLESSSARWVLYSSCNADTLARDLERMPSLRPAKVRLLDMFPQTRHYEVLTLLERH 411
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap