Conserved Protein Domain Family
PRK03288

?
PRK03288: PRK03288 (this model, PSSM-Id:101200 is obsolete)
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase; Provisional
Statistics
?
PSSM-Id: 101200
View PSSM: PRK03288
Aligned: 39 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 22-Jul-2008
Updated: 31-Jul-2008
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
157145529   2 MTHWPSPAKLNLFLYITGQRADGYHTLQTLFQFLDYGDTIGITPRGDGEIHLLTPVEGVENDDNLIVRAARLLMKTASAH 81 
37525984    2 TFTWPSPAKLNLFLYITGRRADGYHQLQTLFQFLNYGDEITITPRQDNEIRLLTPVEGVEHDNNLIVRAARLLQSYSDKH 81 
123442670   1 ---------MNLFLYITGQRTDGYHLLQTLFQFLDYGDELTIVPRDDDQIRLLTPIVGVENEQNLIIRAARLLQQ---HP 68 
162421804  12 PAKWPSPAKLNLFLYITGQRADGYHQLQTLFQFLDYGDQLTIEPRDDNQIRLLTPIAGVENEQNLIVRAAKMLQK---HP 88 
108807394  12 PAKWPSPAKLNLFLYITGQRADGYHQLQTLFQFLDYGDQLTIEPRDDNQIRLLTPIAGVENEQNLIVRAAKMLQK---HP 88 
16122257   12 PAKWPSPAKLNLFLYITGQRADGYHQLQTLFQFLDYGDQLTIEPRDDNQIRLLTPIAGVENEQNLIVRAAKMLQK---HP 88 
22126178   12 PAKWPSPAKLNLFLYITGQRADGYHQLQTLFQFLDYGDQLTIEPRDDNQIRLLTPIAGVENEQNLIVRAAKMLQK---HP 88 
108811659  12 PAKWPSPAKLNLFLYITGQRADGYHQLQTLFQFLDYGDQLTIEPRDDNQIRLLTPIAGVENEQNLIVRAAKMLQK---HP 88 
145598399  12 PAKWPSPAKLNLFLYITGQRADGYHQLQTLFQFLDYGDQLTIEPRDDNQIRLLTPIAGVENEQNLIVRAAKMLQK---HP 88 
45441666   12 PAKWPSPAKLNLFLYITGQRADGYHQLQTLFQFLDYGDQLTIEPRDDNQIRLLTPIAGVENEQNLIVRAAKMLQK---HP 88 
157145529  82 GRLPAGSGADISIEKRLPMGGGLGGGSSNAATVLVALNHLWQCGLSVDELAETGLTLGADVPVFVRGHAAFAEGVGEILT 161
37525984   82 HAGIAHKGADIHINKRLPMGGGLGGGSSNAATVLIALNYHWQTGFTDETLAALGVSLGADVPIFVKGHAAFAEGIGEILH 161
123442670  69 SSAKVPRGADISIDKRLPMGGGLGGGSSNAATVLVALNTLWHCGLSDEELAALGLTLGADVPVFVRGHAAFAEGIGEKLH 148
162421804  89 GNTPVPRGADISIDKCLPMGGGLGGGSSNAATVLVALNLLWQCGLTDEQLADLGLTLGADVPVFVRGHAAFAEGIGEKLQ 168
108807394  89 GNTPVPRGADISIDKCLPMGGGLGGGSSNAATVLVALNLLWQCGLTDEQLADLGLTLGADVPVFVRGHAAFAEGIGEKLQ 168
16122257   89 GNTPVPRGADISIDKCLPMGGGLGGGSSNAATVLVALNLLWQCGLTDEQLADLGLTLGADVPVFVRGHAAFAEGIGEKLQ 168
22126178   89 GNTPVPRGADISIDKCLPMGGGLGGGSSNAATVLVALNLLWQCGLTDEQLADLGLTLGADVPVFVRGHAAFAEGIGEKLQ 168
108811659  89 GNTPVPRGADISIDKCLPMGGGLGGGSSNAATVLVALNLLWQCGLTDEQLADLGLTLGADVPVFVRGHAAFAEGIGEKLQ 168
145598399  89 GNTPVPRGADISIDKCLPMGGGLGGGSSNAATVLVALNLLWQCGLTDEQLADLGLTLGADVPVFVRGHAAFAEGIGEKLQ 168
45441666   89 GNTPVPRGADISIDKCLPMGGGLGGGSSNAATVLVALNLLWQCGLTDEQLADLGLTLGADVPVFVRGHAAFAEGIGEKLQ 168
157145529 162 PVDPPEKWYLVAHPGVSIPTPVIFKDPELPRNTPKRSIETLLKCEFGNDCEVIARKRFREVDAALSWLLEYAPSRLTGTG 241
37525984  162 IAEPEEKWYLVAHPGIEISTLRVFTDPELKRDTPIRPLAALLKAPYLNDCESLVRKRFRKVEQLLSWLLEYAPSRLTGTG 241
123442670 149 PAEPIEKWYLVVHPGVNIPTPIIFSDPELKRNTPIRPLAALLSAPYANDCEPIARKRFREVEQALSWLLEYAPSRLTGTG 228
162421804 169 PAEPVEKWYLVIHPGVNIPTPIIFSDPELKRNTPIRPLAALLSTPYANDCEPIARKRFREVEQALSWLLEYAPSRLTGTG 248
108807394 169 PAEPVEKWYLVIHPGVNIPTPIIFSDPELKRNTPIRPLAALLSTPYANDCEPIARKRFREVEQALSWLLEYAPSRLTGTG 248
16122257  169 PAEPVEKWYLVIHPGVNIPTPIIFSDPELKRNTPIRPLAALLSTPYANDCEPIARKRFREVEQALSWLLEYAPSRLTGTG 248
22126178  169 PAEPVEKWYLVIHPGVNIPTPIIFSDPELKRNTPIRPLAALLSTPYANDCEPIARKRFREVEQALSWLLEYAPSRLTGTG 248
108811659 169 PAEPVEKWYLVIHPGVNIPTPIIFSDPELKRNTPIRPLAALLSTPYANDCEPIARKRFREVEQALSWLLEYAPSRLTGTG 248
145598399 169 PAEPVEKWYLVIHPGVNIPTPIIFSDPELKRNTPIRPLAALLSTPYANDCEPIARKRFREVEQALSWLLEYAPSRLTGTG 248
45441666  169 PAEPVEKWYLVIHPGVNIPTPIIFSDPELKRNTPIRPLAALLSTPYANDCEPIARKRFREVEQALSWLLEYAPSRLTGTG 248
157145529 242 ACVFAEFDTESAARQVLKQAPEWLNAFVAKGVNLSPLQKAML 283
37525984  242 ACVFGEFESEASARKVLNQAPEWLQGFVARGVNNSPLHNFRS 283
123442670 229 ACVFAEFDTESSARQVLSIAPEWLHGFVARGVNLSPLHRVRS 270
162421804 249 ACVFAEFDTESSARQVLSIAPEWLHGFVARGVNVSPLHRVRS 290
108807394 249 ACVFAEFDTESSARQVLSIAPEWLHGFVARGVNVSPLHRVRS 290
16122257  249 ACVFAEFDTESSARQVLSIAPEWLHGFVARGVNVSPLHRVRS 290
22126178  249 ACVFAEFDTESSARQVLSIAPEWLHGFVARGVNVSPLHRVRS 290
108811659 249 ACVFAEFDTESSARQVLSIAPEWLHGFVARGVNVSPLHRVRS 290
145598399 249 ACVFAEFDTESSARQVLSIAPEWLHGFVARGVNVSPLHRVRS 290
45441666  249 ACVFAEFDTESSARQVLSIAPEWLHGFVARGVNVSPLHRVRS 290
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap