Conserved Protein Domain Family
PRK03009

?
PRK03009: PRK03009 (this model, PSSM-Id:101165 is obsolete)
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase; Provisional
Statistics
?
PSSM-Id: 101165
View PSSM: PRK03009
Aligned: 26 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 22-Jul-2008
Updated: 31-Jul-2008
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
163858321   1 MLYDVPAPAKLNLFLHVVGRRPDGYHLLQTVFGFIDLCDTLHFEARADGRIERAADLPGVPPEHDLTLRAARALQQATGT 80 
119897047   6 VLAGCPAPAKLNLFLHVVGRRDDGYHLLQTAFRLLDWGDRLDFRVRDDGLIRRTNQVAGVAEDDDLVVRAARRLQQATGT 85 
33599889    2 TLYDVPAPAKLNLFLHVVGRRADGYHLLQTAFRFIDLADTLHFEARADGAIGRAYELPGVAESDDLVVRAARSLQRATGT 81 
33595504    2 TLYDVPAPAKLNLFLHVVGRRADGYHLLQTAFRFIDLADTLHFEARADGAIGRAYELPGVAESDDLVVRAARSLQRATGT 81 
33594047    2 TLYDVPAPAKLNLFLHVVGRRADGYHLLQTAFRFIDLADTLHFEARADGAIGRAYELPGVAESDDLVMRAARSLQRATGT 81 
161523694   7 SLRNCLAPAKLNLFLHITGRRPNGYHDLQSVFQLLNWGDTLHFTLRDDGKVARATDVPGVPEQSDLVVRAANLLKAHTGT 86 
91781714    7 SLRDCLAPAKLNLFLHITGRRPDGYHTLQTVFQLLDWGDTLHFTRRDDGLITRRTEIADVPPEHDLTVRAATLLKTHTGS 86 
113866403  11 ELRDCPAPAKLNLFLHVTGRRADGYHTLQTVFQLVDWCDTLHFRRRDDGVVARVTDVPGVPAETDLVVRAARALQAATGA 90 
73540049   15 ELRDCPAPAKLNLFLHVTGRRPDGYHMLQTVFQLVDWCDTLHFRRRDDGVVTRTTDIPGVPAETDLIVRAARALQQATGT 94 
94309235   11 ELRNCPAPAKLNLFLHVTGRRPDGYHTLQTVFQLIDWSDTLHFHRRDDGVITRVTDIPGVPADTDLVVRAARAMQAASGT 90 
163858321  81 RQGAVISLEKRIPQGGGLGGGSSDAATTLIALNRLWGTGLSRSDLMALALPLGADVPVFVYGQPAFAEGVGEQLAPVALP 160
119897047  86 PLGADITLHKVLPMGGGVGGGSSDAATTLIALNHLWQTGLTRADLQQLGLALGADVPFFIYGRDAFAEGVGEAFQPLALP 165
33599889   82 RQGAQIGLHKRIPQGGGLGGGSSDAATTLIALNRLWGTGLSRSQLMQLALPLGADVPVFVFGQSAFAQGVGEDLTAVALP 161
33595504   82 RQGAQIGLHKRIPQGGGLGGGSSDAATTLIALNRLWGTGLSRSQLMQLALPLGADVPVFVFGQSAFAQGVGEDLTAVALP 161
33594047   82 RQGAQIGLHKRIPQGGGLGGGSSDAATTLIALNRLWGTGLSRSQLMQLALPLGADVPVFVFGQSAFAQGVGEDLTAVALS 161
161523694  87 AAGVDIEIDKCLPMGAGLGGGSSDAATTLLALNRLWQLDLPRAELQSLAVKLGADVPFFVFGKNAFAEGIGEELAEVELP 166
91781714   87 PEGVDIEIDKRLPMGAGLGGGSSNAATTLLALNRLWKLNLPRLELQALALKLGADVPFFVFGKNAFAQGVGEALDVVQLP 166
113866403  91 TFGADIAIDKVLPMGGGIGGGSSDAATTLLALNHLWGLGLARAELMRIGLALGADVPVFVLGQNAFAQGIGEDLTPVELP 170
73540049   95 RFGADIAIDKILPMGGGIGGGSSDAATTLLALNHLWGLGLPRAELMRIGLALGADVPVFVFGENAFAEGIGEELTAVDLP 174
94309235   91 RFGVDIAIDKILPMGGGIGGGSSDAATTLLALNRLWGVNLPREELMRIGLSLGADVPVFVFGQNAFAEGVGEELTPVALP 170
163858321 161 PAVYLVVQPDASVPTAGIFADPDLTRDTPSVTIADFLASQDfdvagsagggrdlfgRNDLEPVVYRRYPEVLGAAQWLSG 240
119897047 166 AAVYVVLSPEVSVPTAEIFSAKGLTRDTPPIRIADFAASPT---------------RNDLQATACSRYPEVARAINWLEH 230
33599889  162 PAAYLVVQPDAGVPTAAIFSDPDLTRDCASVTIADFLALPTfc-----------fgRNDLEPVVLRRYPEVSGAVRWLFE 230
33595504  162 PAAYLVVQPDAGVPTAAIFSDPDLTRDCASVTIADFLALLTsc-----------fgRNDLEPVVLRRYPEVSGAVRWLFE 230
33594047  162 PAAYLVVQPDAGVPTAVIFSDPDLTRDCASVTIADFLALPTsc-----------fgRNDLEPVVLRRYPEVSGAVRWLFE 230
161523694 167 TRWFLVVTPRVHVPTAEIFSDELLTRDSKPVTITDFLAQQSsdarw-----pdsfgRNDMQQVVTSKYAEVAQVVKWLYN 241
91781714  167 PRHFLVVTPRVHVPTAAIFSEKALTRDSKPLTITDFPAELScntew-----pesfgRNDMQQVVVGKYAEVAQVLRWFEN 241
113866403 171 ESWFVVIHPKQHVPTAEIFSDECLTRDTPLSIIAVFAARTNkfd----------fgRNDLEPIATAKFGEVARALAWLKQ 240
73540049  175 DSWFVIVHPKQHVPTAEIFSDECLTRDTPLSIIAVFAACTNkfs----------fgRNDLEAIATAKFGEVARALEWLKQ 244
94309235  171 DSWFVVIHPRQHVPTAAIFSDERLTRNSPISIVADFAACTNkfa----------fgRNDLETIATAKFGEVARALEWLKN 240
163858321 241 RGIhARMSGSGACLFARYATMQQAVLAQQEITATMRVAgetaghtqpgfrlvrACPGLAEHPLRNWIA 308
119897047 231 YAP-ARMTGSGACVFAEVASEIEADEIVSLCPARWKAW---------------KAKSLARHPLYGLLD 282
33599889  231 HGLrVRMSGSGACLFAEFPTLPEAVLAQEEITATMRVAgkttshthpgfrlvqASTGLTEHPLRNWIA 298
33595504  231 HGLrVRMSGSGACLFAEFPTLPEAVLAQEEITATMRVAgkttshthpgfrlvqASTGLTEHPLRNWIA 298
33594047  231 HGLrVRMSGSGACLFAEFPTLPEAVLAQEEITATMRVAgkttshthpgfrlvqASTGLTEHPLRNWIA 298
161523694 242 VAP-ARMTGSGASVFAAFQSKQQAEAAKAQLPAGWNGA---------------VAESLNEHPLFAFAS 293
91781714  242 VAP-ARMSGSGASVFAAFRSKAEAEAVQAKLPAEWNSA---------------VAASLDQHPLFTFAS 293
113866403 241 HNQhARMTGSGACVFARFPDAATAQQVLERLPPEWDGR---------------CVRSLARHPLAALA- 292
73540049  245 FNQhARMTGSGACVFARFPDEQKAQQVLKRLPPEWDGR---------------CVRSLARHPLAAFA- 296
94309235  241 YSPhARMTGSGACVFARFEDEQTAQRVMERLPSEWDGR---------------CVKSLSHHPLATFA- 292
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap