Conserved Protein Domain Family
PRK02534

?
PRK02534: PRK02534 
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase; Provisional
Statistics
?
PSSM-Id: 235049
View PSSM: PRK02534
Aligned: 36 rows
Threshold Bit Score: 455.891
Threshold Setting Gi: 86605006
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
298492283   1 MRSYSLIAPAKINLYLEIIGNRPDGYHELAMILQSIDIADQINLQAASTEEIHVYCNHPQVPADQSNLAYRAAELMARQF 80 
72382119    8 EDFLIANAHAKINLHLEVLGIRSDGFHELAMVMQSINLSDQLKMIKRVDNTINLKSNNKEISNGDDNLIIKAAKLLRNKV 87 
78779251    6 KTKINIKSPAKINLHLEVIGKREDGFHELAMIMQNIDLSDYLEFEINNEGLIKLESDCNDLSLSDDNLIVKSANLLRKKS 85 
159903253   9 AESLKVYASAKINLHLEVLGLRKDGFHELAMVMQSIDLVDEIEITKTNDELISLNSDNPELDNGDGNLIIKAAKLIRSRS 88 
157413293   6 GKKIIIKSPAKINLHLEVIGKREDGFHELAMIMQNIDLFDYLEFQINNEGLIKLESDCTDLSLSSDNLIVKSANLLRKKL 85 
123968461   6 KKKINIKSPAKINLHLEVIGKREDGFHELAMIMQNIDLADYLEFEINNEGLIKLESDCNDLSLSDDNLIVKSANLLRKKS 85 
123966248   6 TTKICVKSPAKINLHLEIIGKREDGYHELAMIMQNIDLFDYIEFENNQIGDIELKSNNKDLSLKDDNLIIKAANYVKDIS 85 
126696264   6 KPKIKIKSPAKINLHLEVIGKREDGFHELAMIMQNIDLSDYLEFEINNEGLIKLESDCNDLSLSDDNLIVKSANLLRKNS 85 
124025655   8 EDFLIAKAHAKINLHLEVLGIRSDGFHELAMVMQSINLSDQLKMIKRVDNTINLKSNNKEISNGDDNLIIKASKLLRNKV 87 
33240214   11 SRSLSVIAPAKINLHLEVLGFRKDGFHELAMLMQSINLFDEIDFLKTDNGEITLTSDDPNLSTGDDNLILKAAQLIQTCS 90 
298492283  81 PDVFsnfGGIDITVTKRIPVAAGLAGGSTNAAAVLVGIDLLWDLGLTKSELEELGATLGSDVSFCISGGTAIATGRGELL 160
72382119   88 ENQE---LGVDIELEKNIPIGAGLAGGSTDAAATLLGLNKLWKLNLKIDELENLSKEIGSDIPFCISGGRQICFGRGEIL 164
78779251   86 NID----YGANIFLRKNIPIGAGLAGGSSNSAATLIGLNKLWDLNLGQEALCSLASTLGSDIPFFINGGIQLCFGRGEVL 161
159903253  89 GLRD---LGALIYLRKKIPIGAGLAGGSSDGAATLVGLNSLWGLNFSNNQLEDMAAELGSDVPFCISGGAQLCFGRGECL 165
157413293  86 NID----CGANIFLRKNIPIGAGLAGGSSNAAATLIGLNKLWDLNVDQKTLFSLASTLGSDIPFFINGGIQLCFGRGEIL 161
123968461  86 NID----YGANIFLRKNIPIGAGLAGGSSNAAATLIGLNNLWDLKLDQETLCSLASTLGSDIPFFINGGIQLCFGRGEIL 161
123966248  86 KKKD---LGANIFLKKNIPIGAGLAGGSSNAAATIIGLNKLWDLDLDNETMLSLSSKLGSDVPFFINGGCQFCFGRGEIL 162
126696264  86 NIN----YGANIFLRKNIPIGAGLAGGSSNAAATLIGLNKLWNLDLDHGTLCSLASTLGSDIPFFINGGIQLCFGRGEIL 161
124025655  88 ENQE---LGVDIELEKNIPIGAGLAGGSTDAAATLLGLNKLWKLNLKTDELENLSKEIGSDIPFCISGGRQICFGRGEIL 164
33240214   91 SDKN---VGAEIHLKKNIPIGAGLAGGSSDAAATLVGLNSLWGIGSSEKQLEKLGSELGSDVPFCLRGGTQFCFGRGESL 167
298492283 161 SPLPSLN-QIHLVLAKYLSLEVSTPWAYKTYRQEFGNSYVKNTEDLVARANAVHSGEMVKAILDKDAAKisqkLHNDLEK 239
72382119  165 EKLKFDQiQLGLVLVKDPSIQVSTPVAYKKYKEQFGESYLEDDRDFEIKRNSIRSIDWSDQSLFDNRKE----IQNDLQK 240
78779251  162 EKLDSNF-EYGVILLKNPNVSVSTAETYKKYSNRFCHQYLTDREMIENIRKNLRENGLNNLNLDNQHLS----IKNDLQL 236
159903253 166 EPLDKSDpTLAIVLVKDPSVSVSTPWAYSRYKQLNESTYLSKEIDFQEKRMALRKASWLRPLNASNPPP----LINDLQE 241
157413293 162 EKLDSNF-DYGVILLKNPNVSVSTAETYSKYSNRFCYQYLTNGEMIENIRNNLRDNGLNNLNFDKQHLT----IKNDLQL 236
123968461 162 EKLDSTL-EYGAILLKNPNVSVSTAETYKKYSNRFCDQYLTDREMIENIRKNLRDNGLNNLNFDNQHLS----IKNDLQL 236
123966248 163 ENYNSKF-DYGVILLKNPNISISTADTYKKYSKEYCSNFLTESEKTNDIRNDLRINGFNDLNSSNQIIK----VKNDLQI 237
126696264 162 EKLDSNF-EYGVILLKNPNVSVSTAETYKKYSNRFCDNHLNDRKMIENIRKNLRDNGLNKLNFDNQHLF----IKNDLQL 236
124025655 165 EKLKFDQiQLGLILVKDPSIQVSTPVAYKKYKDQFGESYLEDDRDFEIKRNSIRSIDWSDQSLFDNRKE----IQNDLQK 240
33240214  168 EMIPEIKqSMAVVLVKDPLVEVSTPWAYSKFKEIYGNDYLKMEEDFEKRRQSLRDASWLNPLNCTNPPP----LQNDLQK 243
298492283 240 VVLPAYPQVLQLRELFAtQEGVLGTMMSGSGPSVFAIVESKAQAEIVKQQIRTAIPDEDLELFVTQTIANGIQIL 314
72382119  241 SIRPMTPEVEKSLNLLSsLPDSRLVSMSGSGPSCFALFQNYDQANKVLKEHVNEFERAGLSAWACSMMSNGVELR 315
78779251  237 VVENENDSVKQALYLLSkLENCLTFSMSGSGPTCFALFKDIETAKKELTANYKLFRNKGYDSWVCTFLEKGITFI 311
159903253 242 VVAPATPAVEKALQFLRsLKGVLSVAMSGSGPSCFAIFSDLDQARIALEENQEELRKQCLEGWCCALNSKGVRFA 316
157413293 237 VVENDNDSVKEALYLLSkLENCLTFSMSGSGPTCFAIFKDIETAKKELNANSKLFEDKGYDAWVCTFFEKGITFI 311
123968461 237 VVENENDSVKQALYLLSkLENCLTFSMSGSGPTCFALFKDKETAKKELTANSKLFKDKGYDSWVCTFLEKGITFI 311
123966248 238 IVEKENDSVKKALYLLSnLQNCLSFSMSGSGPTCFALFKDINKANEVFEQNHKMFNNNGFEAWVCKLINSGITFL 312
126696264 237 VVENENDSVKQALYLLSkLENCLTFSMSGSGPTCFALFKDIETAKKELTANSKFFKDKGYDSWVCTFLEKGITFI 311
124025655 241 SVRPITPEVEKSLDLLSsLPDSRLVSMSGSGPSCFALFQNYDQANKVLKEHVNEFERAGLSAWACSMMSNGVELR 315
33240214  244 VIEPITPAVRNALEFLSsLEGVLSLAMSGSGPSCFGIFADLNGAQIALEENRNKLKLSGLDAWCCAFKSSGVSLR 318
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap