Conserved Protein Domain Family
PRK02382

?
PRK02382: PRK02382 
dihydroorotase; Provisional
Statistics
?
PSSM-Id: 179417
View PSSM: PRK02382
Aligned: 19 rows
Threshold Bit Score: 671.363
Threshold Setting Gi: 15791288
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73669289    1 MPDILIKNTRIYYNNSLQSAEIIIEDGKVTKI---GKDLRVSSSDMIIDAGGALTLPAGIDVHVHFREPGMTSKENWYTG 77
gi 294495557   1 MNDILIKNTKVFYKNQLQPGEVLIDEGKIKKI---AKNLKGEEADIHIDAHGGLTIPAGIDVHVHFREPGMTQKEDWYSG 77
gi 21228113    1 MPDIHIKNTRIYYNNSLQPAEIIIEHGKITKI---GKDFRVSSSDMVIDAKGSLTLPAGIDVHVHFREPGMTLKENWYTG 77
gi 20089776    1 MPDIHIKNTRIYYNNSLRPAEILIENGKITKI---GKDFRVSSSDMVIDAEGALTLPAGIDVHVHFREPGMTLKENWYTG 77
gi 91772776    1 MTDILITNTKVFYNNILQPGEIQINDGKIQRI---AKNITSADPDLLIDAKGALTIPGGIDVHVHFREPGMIKKEDWYTG 77
gi 292655956   3 IENATLADGRA--------VDVRVEDGTVEAV---G-DLDSVDAEETVDAEENLLLPGAIDVHVHFREPGFEHKETWETG 70
gi 298675623   1 MSNILIKNTRIFYNNRLQPAEVLIDNGKISKI---AKDIRISHVDREIDADNALTLPAGIDAHVHFREPGQTRKEDWYTG 77
gi 222480488   3 ITGAELADGRV--------RDVRIRDGTIDAVeptNAGLDADTGERVVDARGRHLLPGAVDVHVHFREPGASHKETWTSG 74
gi 147921110   1 MHELVVEDAMVSFDGEILACSIGIDEGKITRI---AKVLKG---EEKYDARGRLVMPGVIDSHVHFRDMRQEEKEDWLSG 74
gi 300712330   3 ITNATLADGRT--------VDVRIEGERIGAV---KPQLPG---EPDVDATGKLLMPGAIDAHVHFREPGFPHKETWETG 68
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73669289   78 SCAAAAGGVTTVIDQPNTVPPTTDRRTFEQKLILARRKSIVDFGINGGVTGNIDKLEELWKLGVTAFGEIFMAESTGGLN 157
gi 294495557  78 SCAAAAGGIGTVVEHPNTLPPVLDRKSFREKFKLANRKSIIDFGINGGVGKNIEKLESLWELGVTAFGEIFMAESTAGLG 157
gi 21228113   78 SCAAAAGGIATVIDQPNTIPPTTDRRSFEQKLELARKKSIVDFGINGGVTGNIEKLKELWRLGVTAFGEIFMAESTGGLN 157
gi 20089776   78 SCAAAAGGIATVIDQPNTIPPTTDRRSFEQKLKLARKKSIVDFGINGGVTGNIEKLRELWRLGVTAFGEIFMAESTGGLN 157
gi 91772776   78 SCSAAAGGTTTVVEHPNTIPPTIDKSSFKEKLKLANRKSIIDFGINGGVTKNLESLSLLWELGVTSFGEIFMAESTGGLN 157
gi 292655956  71 ARSAAAGGVTTVADQPNTDPTTTDGAGFDVKAECAAN-ACIDYGINGGVTADWDP-DSLFDRPLFALGEVFLADSTGDMG 148
gi 298675623  78 SCSAAAGGITTVIDHPNTAPPTIDEKSFNKKLNLASKKSIVDFGINGGVTNNFDNLSRLWELGATAFGEIFMAESTGELN 157
gi 222480488  75 SRGAAAGGVTTVVDQPNTSPPTVDGDAFDEKAALAAD-SLVDYGINGGVTADWDP-ESLFERPLFALGEVFLADSTGDMG 152
gi 147921110  75 SKAALYGGVTTVVDMPNSDPPTFDAEAFKVKQTVAANRSMVDFSLNAGVGDNLPQLPQLWKLGALAFGEIFMAKSTGGFS 154
gi 300712330  69 SQSAAAGGVTTVVDQPNTDPPTVDGASFDAKAELARE-SYVDYGINGGVTEGWDP-DELFSRPVFALGEVFLADSTGEMG 146
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73669289  158 INEETFDEALAEIRRLGALATIHAEDEKMRLELEGLLK-----GDISYEYHSRVRPNACESVAVQKALELVSKLQVRAHL 232
gi 294495557 158 LDSELLKEALGTIQQLGALACVHAEDENIRRDNEILLK-----KDFTPQSHSRIRSNQCEAMAVKNALELSGLASVNTHF 232
gi 21228113  158 IKEEDFEEALAEIKRLGALATIHAEDEKMRLELEQLLK-----GDVSCDYHSKVRPNACEASAVQCALEIISRLGVKAHF 232
gi 20089776  158 INEETFEEALAEIKKLGALATIHAEDEKMRLELEQLLK-----GDVSYDYHSKVRPNACEASAVQSALELISRLQVRAHF 232
gi 91772776  158 IDEKDFSEALGIIKELDAVACIHAEDENIRLENEKLLK-----HDLSPNSHSRIRSNLCEGIAVQNALETIAEKGTRSHF 232
gi 292655956 149 IEADLFAEAAERAGEAGVPVTVHAEDADLFDESAIEGDlggvgRDADADAWSAYRTAGAEAVAVERAVRVGGETGAQIHI 228
gi 298675623 158 ISEESFNQALSEIKELGAVACIHAEDEDIRLKNESLLK-----NDMSPQSHSRARPNICESTAVQKAVDMISSFDTQSHF 232
gi 222480488 153 IALDLFEEALAEAAARDVPVTVHAEDETLFDESALDGDlggvgTAANADAWSAYRTAEAETAAIERALDAGAESDAQVHI 232
gi 147921110 155 IDEPALKEALKAITLMGATASIHAEDEALHEELKKSLK-----HDPSSSIHSKLRPRESEINAVEAAIRLARETRVAMHI 229
gi 300712330 147 IGTELFERAVERAAHEDTVVTVHAEDATRFDRRALEAAgdgigREGDADAWSAFRSAAAETAAVELACEVGARSDAAIHI 226
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73669289  233 CHISTLEATGIIRKEKylarrenkeplFTCEVTPHHLFLSTRDWEKLRSFGKMNPPLRGSHSIKALMNGINDGTIDMVAS 312
gi 294495557 233 CHISTLEAFGQLKREKyilgkedvsrhLSFEVAPHHLFLSDRDWERLGTFGKMNPPLRNRQSVKALVNGINDGTVDVVAS 312
gi 21228113  233 CHLSTLEAVGMIRKEKylakrenkeplFTCEVTPHHLFLSTRDWERLGVFGKMNPPLRGSHSIKALVNGLNDGTIDMVAS 312
gi 20089776  233 CHLSTLEAVGMIRKEKylakrenkkplFTCEVTPHHLFLSAKDWERLRAFGKMNPPLRGSHSIKALVNGLNDGTIDMVAS 312
gi 91772776  233 CHISTLDALGLIRKEAyvaqnegreskVTCETAPHHLFLSTRDWDRLGTFGKMNPPLRDRRNVKALMNAINDGTVNAIAS 312
gi 292655956 229 AHTSTPEGVDAARDGG-----------ATCEATPHHLFLSRDDLDELGTYGRMNPPLRSEARREAMFERLADGRIDMVAT 297
gi 298675623 233 CHISTSEALGIIRNQKymaykgnrkssITCESAPHHLFLSDKSWDDLGSFGKMNPPLRTRKSVQALVNAINEGTVDMVAS 312
gi 222480488 233 AHTSTPEGIDAVSDTD-----------ATCEVTPHHLFLSREDAGRLGTFGRMNPPLRSEERRAAVFERLRDGDVDVVAT 301
gi 147921110 230 THISTSRAVELISREG-----------ITCDVTPHHLLLTMDHWDRLGSHAKMNPPIRHDSDRNALWKAVNDGSIEVLAS 298
gi 300712330 227 AHTSTPEGIDAAVRAG-----------ATCEVCPHHLFLSRDDLEELGTLGRMNPPLRSEERREAVFERVRDGTVDIVAT 295
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73669289  313 DHAPHLESEKDVDIRAAPSGVPGVETLMPLMLAAVRKNILPLSQMIMLTSWNPAKAFGLDr-kAKGRLEVGFDADLIIVN 391
gi 294495557 313 DHAPHRESEKEGDIKSAPSGVPGVETLMPLMMVGVKRNLFPLKRLIEVTSSNPARIFGLDn-hGKGVFAEGYDADLIIMD 391
gi 21228113  313 DHAPHLESEKGPDIRAAPSGVPGVETLMPLMLAAVRKNILPLAKMIMLTSWNPARAFGLDl-lGKGKLEVSYDADLMIVD 391
gi 20089776  313 DHAPHLESEKDLDIRAAPSGVPGVETLMPLMLAAVRKNILPLSQMIMVTSWNPAKAFGLDr-lGKGWLEVGFDADLMIVD 391
gi 91772776  313 DHAPHSEFDKDLDIRSAPSGVPGVETLMPLMLMAVKKNLLPIGRMIEVTSRNPARIFGLDtkhSKGVFAEGYDADLIIVD 392
gi 292655956 298 DHAPHTREEKERSLLDAPSGVPGVETMVPLLLGAVVAGDLTAERVRDVVAANPADVFDLP---RKGRIEAGADADLALYD 374
gi 298675623 313 DHAPHREFEKDMDIKNTPSGVPGVETLLPLMLAGVKKNLFPLGKVIDVTSKNPAKRFGLDs-nYKGLFKEGFDADLILVN 391
gi 222480488 302 DHAPHTVAEKRQRLVDAPSGVPGVETLYPLLLESVRKGNLSLERVRDVVAANPASIFEIE---GKGRIEPGADADLVVVD 378
gi 147921110 299 DHAPHTLDEKNLPVREAPSGVPGVETMLPLMLKAVADKRLPLQRLIDMTSANPARIFGIE---GKGSFAAGNDADMVFVD 375
gi 300712330 296 DHAPHTREEKEAGIREAPSGVPGVETMVPLLLAAAERGEFARERVRDLVATNPARVFCLP---RKGKIEEGMDADLALYD 372
                        410       420       430       440       450       460
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 73669289  392 PRELRPIKAEFLHSKAGWTPFEGMEGVFPEYTLSRGEVIWIEEsINAKPGRGNFLEGRGERFEED 456
gi 294495557 392 PGNVKSINSNMLHSKAGWTPYEGMKGIFPEYTISRGEIIWDGD-IVGRRGRGNFLPGGGSVKDDE 455
gi 21228113  392 PRNLQPVRADMLHSKAGWTPFEGIDAVFPEYTLSRGEVIWMEEsINAKPGRGKFLEGKGKMSEED 456
gi 20089776  392 PRNLQPIRADMLHSKAGWTPFEGMDAVFPEYTLSRGEVIWMEDsINAKPGRGEFLEGSGKRSEED 456
gi 91772776  393 THTATPIKADKLHSKAGWTPFENMDAIFPKMTISKGEVIWDGE-LIAEKGRGSFLEGCGCLEDE- 455
gi 292655956 375 LDAAREIRGADLHSNCEWTPFEGHTGVFPEWTMLRGEFVWDGDeFGAV--AGENVRD-------- 429
gi 298675623 392 PQDMRKISSDFLHSKAGWTPYSGLYGIFPQLTISRGDIIWDGE-ITATRGRGNFLKGRGYLMDTE 455
gi 222480488 379 LTNPREIEAGALHGASGWTPFEGLQGVFPELTTVRGKIAYERDpVTGAESFGETVGRNVRES--- 440
gi 147921110 376 MAKVRQITPAGLHSKAGWTPYRGFEAIFPEAVMLRGDIVLDGKdFYAKRGTGKFIPGKGYKRLSD 440
gi 300712330 373 PDRIEAIHGESLHSKADWTPFEGHEGVFPELTLVRGTVVYDHGk---EGENGEFGRPAGRNVRR- 433
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap