Conserved Protein Domain Family
PRK02224

?
PRK02224: PRK02224 
chromosome segregation protein; Provisional
Statistics
?
PSSM-Id: 179385
View PSSM: PRK02224
Aligned: 15 rows
Threshold Bit Score: 934.457
Threshold Setting Gi: 222478619
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73667909     1 MKLKNLHIENIRSYKKLDFTFEDGVTVISGVNGSGKSSLLEACFMGLFGSKILSkDfVLADVIFKGAENAKINLGFEHLG 80
gi 21228296     1 MKLKNLYIENIRSYKKLDFTFEDGVTVISGVNGSGKSSLLEACFMGLFGSKILSkDfVLADMIFKGAESAKIHLGFEHLG 80
gi 15789741     1 MRFTRLSLSNFKCYADAAVSLDPGVTVIHGLNGSGKSSLLDACFFALYGTTALD-T-TLADAVTIGAETAEIDLHFEHAG 78
gi 169235456    1 MRFTRLSLSNFKCYADAAVSLDPGVTVIHGLNGSGKSSLLDACFFALYGTTALD-T-TLADAVTIGAETAEIDLHFEHAG 78
gi 292655017    1 MRFTRIAIRNFKPYEDAELDLRDGVTVIHGVNGSGKSSLLEACFFALYGSKALA-G-TLEDVVTTGADDAEITLEFVHDG 78
gi 222478619    1 MNFDRVRLSNFKPYGDADLRLTEGVTVIHGLNGSGKSSLLEACFFALYGSKALD-G-TLGDVITNGEEETEVDLWFTHDG 78
gi 289582094    1 MRVDRVRMLNFKCYGDADLTLERGVTVVHGVNGSGKSTLLEAVFFALYGSKALD-DrTLDDVITTGENESEVELWFTHDN 79
gi 76801408     1 MRFERIRLRNFKCYAETELSLREGVTVIHGVNGSGKSSLLEACFFALYGSAAID-G-TLDDAIANDADEMSIELWFTHGG 78
gi 284164775    1 MRVDRVRLLNFKCYGEADLGLERGVTVVHGVNGSGKSTLLEAVFFALYGSKALD-DrTLDDVIMTGEEEAEVELWFTHDG 79
gi 110667658    1 MRFDHITLEHFKPYADASLDLQDGVTIIHGLNGSGKSSLLEACFFALYGARALD-E-TLDDIVTTDEDDATIELTFSHAG 78
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73667909    81 QDYLIEQAFRysSKSENASNSKCVLyANGES---IVDQATRTYEEVCSLLNMDEEAYRNCAYIRQGEIDVLINAKPKDRQ 157
gi 21228296    81 REYLIEQAFRysLKSENASNSRCVLfADGEN---IVDQATRTYEEVCALLNMDEEAYRNCAYIRQGEIDVLINAKPRDRQ 157
gi 15789741    79 GDYHVHRRIR--ASGGRAQTAACVL-ETPTD---RIDGVTDVEAHISGLLRMDAEAFVNCAYVRQGEVNKLINAAPSTRQ 152
gi 169235456   79 GDYHVHRRIR--ASGGRAQTAACVL-ETPTD---RIDGVTDVEAHISGLLRMDAEAFVNCAYVRQGEVNKLINAAPSTRQ 152
gi 292655017   79 GEYRIDRRVR--VSGDRATTAKCVL-DGPEG---TVEGARDVRRHVASLLRMDAEAFVNCAYVQQGEVNKLINATPSQRQ 152
gi 222478619   79 ASYHIERRLK---EYDGRIDHQCTL-ETTDGsdvTRDGARAVREFVTELLRMDAEAFVNCAYVRQGEVNKLINATPRERQ 154
gi 289582094   80 REYHIERHLK--LRGDRATTTKCVL-ETPED---TIEGARDVRKTVTELLRMDAEAFVNCAYVRQGEVNKLIHASPSERQ 153
gi 76801408    79 GEYRIERNIK--RRGGSAQTTTCLL-ETPNG---TVEQVTDVEAHIEELLRMDADAFVNCAYVRQGEVNKLINATPSERQ 152
gi 284164775   80 REYHVERRLK--LRGDRATTTKCVL-ETPTE---TFEGARDVRREVTELLRMDAEAFVNCAYVRQGEVNKLIHASPSDRQ 153
gi 110667658   79 SQYHIKRRLR--RSGDRIQTAQCTL-DGPDI---EIDGATDVRAFITDILRMDAEAFVNCAYVRQGEVNKLINATPTQRQ 152
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73667909   158 RMIDGLLQLGKLEEYRERAGSAKTAVRRLQRDTSNSLSGVKAEIEGIESTEPHAVLNGLRQKIKESDTILKKCNENKEAA 237
gi 21228296   158 RMIDDLLQLGKLEEYRERAGYAKTAVRRLERDAKNSFLGVKAEIEGIESTEPVAAVNRLRQKVKETDAILEELNKKKEFA 237
gi 15789741   153 DMIDALLQLGKLEEYRQRAGDARLGVEDVKSNVEGQLDRLADQIADKEAADPHDRLASHNTALAEVTADIEHFEAEREQA 232
gi 169235456  153 DMIDALLQLGKLEEYRQRAGDARLGVEDVKSNVEGQLDRLADQIADKEAADPHDRLASHNTALAEVTADIEHFEAEREQA 232
gi 292655017  153 DMIDDLLQLGKLETYRERAGNARLGVEDVLTKKRSVLEDVESQIEAKEDADLHATLNALESELDSLDEEISNYESQRDKA 232
gi 222478619  155 DTIDDLLQLGKLEEYRERAGDARLGVEDVLENRRGRLDQLDDQIAEKKEKDLHDRLNGLESDLSEVTDEIDRYETQREQA 234
gi 289582094  154 DMIDDLLQLGALEEYRERASDARLGVKSVLDGQREVLDDVRSQVEQKEEQDLHETLNTLEKERDELTEQIDHYEAQRDQA 233
gi 76801408   153 DMIDSLLQLGTLEEYRERASDARVGVERVLSQQETLLEDKRATIAEKEQKSLHDRLNALRTELSELKSDIETKEEERETA 232
gi 284164775  154 DMIDDLLQLGALEEYRERASDARLGVKTVLDGQREVLEDLHKQVEQKEEKDLHERLNGLESRRADVREKIDRFEEQREQA 233
gi 110667658  153 AIIDDLLQLGRLEMYRERASDARLGVEDILSEQRGAQTEIKAQIERKEDANLHEKLNEYEAARADIDAEIERYEENKIRA 232
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73667909   238 AAQKEKLDLMITEHRERLQEIQTLKQALSKSQEDKAGCIREKEAFAREAHEQRQALLGLEEENNHIRGECGFG------D 311
gi 21228296   238 AARKGELDLRIAEYRERLQEIEVLKQAIRKSQEDKAACFKEKETFSEEVQVQRRVLLELGEENSGMREECGFG------D 311
gi 15789741   233 RQTRDDAADVLERYEESRTALADVEETIADVREAVAEAERERETLADRVSDHRERASDLDDEAAALAADLGLD------D 306
gi 169235456  233 RQTRDDAADVLERYEESRTALADVEETIADVREAVAEAERERETLADRVSDHRERASDLDDEAAALAADLGLD------D 306
gi 292655017  233 KSALDAAEATLDEHAEKRERLDEIESAIEDLTAKISADETKRDDLSERVRELDAAADELESDIDDALARADLD------D 306
gi 222478619  235 KETREAAAETLSTHAEKRETLESVAAEIDEIEATIREAERERDEHRDAVREARERVEEIEAAIDGRLDGAGLD------A 308
gi 289582094  234 VETLETAQEVLERHEETREEIETLGEEIDDLQSKITETERDREDAKDEIRERKEAREELADERNELLADLEREvdpgadS 313
gi 76801408   233 VETKQEAVEVLEAYEQRREEIETLEADIEELTEDIAAAESERDALGERLRSLRETTETLRERRDDALAETELE------R 306
gi 284164775  234 RQTLETAEDVLERHEETREEIDRLDEEIEELRSKITETERKRENAKDEIRDLESRRETLADEREELLAEVDLEdt---dG 310
gi 110667658  233 QETRDNAKEILTSHEETQEELTELEAEIDDLRMTIEEDESTRADFREAIETKTEQVETLLSARTDALSSAEVT------S 306
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73667909   312 LEIEALSLQKEkeeflarekvnviskelalllreeevhtqdlrDFENEKAETEQSLMQCRADIGATNGEIEGNRKNILRI 391
gi 21228296   312 LEIEALLLQQEksessarekvnsgskelalllkeeetgvqalrELEKDKVETERVLVECRTSIGAANKEIEGYRANIKQL 391
gi 15789741   307 PDAEDASAERD--------------------------------AVADQREAVAERVREVAPAVSRLTEQADSAADDAATL 354
gi 169235456  307 PDAEDASAERD--------------------------------AVADQREAVAERVREVAPAVSRLTEQADSAADDAATL 354
gi 292655017  307 ASDEAIADARE--------------------------------ALSARESELRDDLSEARTRAQAFETQAERLRERADDL 354
gi 222478619  309 ASDETIAERRA--------------------------------ELDGREETVREELDDERVSAEAFRNQATNLTGKADDR 356
gi 289582094  314 GAETSVEQHID--------------------------------DLEERDEELQDDLADVRVSIQTKTETADRLREEADDL 361
gi 76801408   307 ADAERVEERLE--------------------------------ELSEAIEGVRETIEEKRLAAQEHLNDAESATDDAEAH 354
gi 284164775  311 ASDKAVEDRIE--------------------------------DLEARDEELRDELEEVRVAITETNGEIERLREEADDL 358
gi 110667658  307 ADADTLAARRS--------------------------------TLDDKESSIRDSLQTARQQQTMFENQAERLTERVDEL 354
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73667909   392 EDENKKLKEAAKettgftdtyeiplfineleekesllrerkneastklalafkeketgdinllTLDKELQNTKVAVRKSK 471
gi 21228296   392 EEENKRLREKAGfgaageiasvikeleekesllrdr----knevstklgfalkekesgdaslrELDSEMQSCRVAVSKGK 467
gi 15789741   355 DERAETLREEAA---------------------------------------------------ALDAEADDAAAKRDDAA 383
gi 169235456  355 DERAETLREEAA---------------------------------------------------ALDAEADDAAAKRDDAA 383
gi 292655017  355 ESRAEEKREAAE---------------------------------------------------VDAETAAEAERELESFR 383
gi 222478619  357 AERAAEIESEAD---------------------------------------------------DLGDEAEAAADEADERE 385
gi 289582094  362 ETRADEARTDAD---------------------------------------------------EIESELETTESEIGDRE 390
gi 76801408   355 RERATEARNEAA---------------------------------------------------TLESDIESARETLETRE 383
gi 284164775  359 EGQAADAREEAA---------------------------------------------------DLESKLEADEEAIADRE 387
gi 110667658  355 ESRADELQEQAS---------------------------------------------------EAETAVTKAKEQITTQQ 383
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73667909   472 TEIEILEEELRENEKAVlevkeqkse---------asaglkglGFTGEQLEDLEYLSELLLENKNRLHGREKELEATLRE 542
gi 21228296   468 SEIEALEKEIRDNSKAVldfqeqkse---------vfaglkalGFTEEQLENLEDFNELLLENKNRLHGKEKELEVTLRE 538
gi 15789741   384 ARIEALDADIEAAMAAF--------------------------DDAPVAFGAAEAFLDDATAERDELRERVATLRADRQS 437
gi 169235456  384 ARIEALDADIEAAMAAF--------------------------DDAPVAFGAAEAFLDDATAERDELRERVATLRADRQS 437
gi 292655017  384 ETRAELRSALDDAEARF--------------------------EDAPVELGEAADLLEERREARSEARESLAETETELKN 437
gi 222478619  386 SSVEELREEAETLRERFa------------------------aADADIDRDGVADEREALRERRGEVRERIAELSAELKN 441
gi 289582094  391 EKLSELEDEIDELRGRFvggdkdededkdededkdedededttDNLTVAFGEAETRLAELESDREDAVAERNDLTADLRT 470
gi 76801408   384 SDLDELDEEIETLREELegeva----------------esddgGDIETRRERLSERRDELRETLAATNERLAERRADLQN 447
gi 284164775  388 GKLEELDEQIEAARERF--------------------------ADAPVDFGDAADHLESLESERDELTGEIGDVTADIRT 441
gi 110667658  384 NAQADIEEQMTSVREQF--------------------------NNSPATLGKATEYLEMLQEEHDDIRNDLASTRASLST 437
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73667909   543 LDKVIRKNRQLLAEGKCPTCGQDLKGSEIACTTGESEQKREKLAAELLDIKLQQAEVEKKLNRLKDAKKLEKRIsdydle 622
gi 21228296   539 IENTLRKNRELLAEGKCPTCGQELKGSGIACTAEECEEKKEKLSLELADIKLQRAELEKKLNRLKEAKKLEKQAydydie 618
gi 15789741   438 AADRVAEAEALLDEGKCPECGQPVEGAPHVERVTDDRERVAELDAELADVEDELDAVAQRVDRGESLVAAEDRV------ 511
gi 169235456  438 AADRVAEAEALLDEGKCPECGQPVEGAPHVERVTDDRERVAELDAELADVEDELDAVAQRVDRGESLVAAEDRV------ 511
gi 292655017  438 ARERLAEAERLRDAGKCPECGQPVEGSPHVDAISEREAAVESLEADRESLESAVESRSAAVEAAEALVEVETRA------ 511
gi 222478619  442 ARDRVEEAEELLAAGKCPECGQPVEDSPHASGIDEDREQVAELEAELEEARERESDLDDRLAELSELASAADRL------ 515
gi 289582094  471 VENAIEEGEALLEEGKCPECGQSVEDSPHVDVLAEKREEAEELEAERETLAAEIEALDERIEQVEDLQEAERRV------ 544
gi 76801408   448 ARERVEEAAALLEAGNCPECGQPIEDESDVEGLEDAREQVGTLETEVEQLEAEVERLEADHERAVKAAETAAEL------ 521
gi 284164775  442 VENAIEEGERLLEEGKCPECGQPVEDSPHVDVLEEKREERDELEERRDKLEDERDDVDERIERAEDLREAERRV------ 515
gi 110667658  438 VQDRRNEAQTLQEAGKCPTCEQPIEESPHVEAIDEYDVQIETLTERLSQLETKQNKVNNKIESAESLVESERQF------ 511
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73667909   623 tERLKNKAKDLQERITIHKTRTEEDSLKLEGLNKQKEELEAKMgkllpdikalQGWEAAAQKAHGESERVLQEAKAFEKK 702
gi 21228296   619 iEKLLEKAKASEKLIDTHRTRIEEDSLKLESSGKRKQELEAAGskllldikalREQEKAAQKVHLESEKALREAKVFERK 698
gi 15789741   512 -DDLEQQRERAVERRDEQADIADAKRDQAAEKRDRAADLDAEA----------EDARADAAAKRDAADEKRETLAALNAD 580
gi 169235456  512 -DDLEQQRERAVERRDEQADIADAKRDQAAEKRDRAADLDAEA----------EDARADAAAKRDAADEKRETLAALNAD 580
gi 292655017  512 -SSRRDRLDLVDERIADREETVESRREAAEEKREAAAELDSEA----------EEKREAATTQAERAEEVAETVDSLESD 580
gi 222478619  516 -DEIDETVETLEDRVEEKHAEADRKREAAAEKRERVEDLREEA----------EETHDVATEKREEAEAAAERVAELEDA 584
gi 289582094  545 -ERLADNRDNVEQLLAQKRETIADRREQCTELREEADELESDA----------EAKREEASELESEVDEVRVELGKINGE 613
gi 76801408   522 -QSSLERRQDVESLLDQQRETIAEKETRAESLREQAADHETEA----------EAAEERAQAAEERAQAAREAIGELNGR 590
gi 284164775  516 -DRLAENRENIEQLLAEKRETLEERREQRDRLREEASEYEDEA----------AEKRAQADDLEEEIADHRGELGAINTE 584
gi 110667658  512 -ETLKERKSLASERIADARETVNEQTETAASLHENAGELETEA----------DEKRDAAATQMSNADSEAEKVATLESK 580
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73667909   703 LAENTSEIESLNgKIRTSLALIENYGQRLGELNEKLKGLAERETQEKEKLKtlevelealrkkealakethdesskhllk 782
gi 21228296   699 LAENASEIESLNgKIRTSLALIENYGQRLGELNEKLKAFAEKETQSKEKLEaleltletarkneeeakkahiesarllge 778
gi 15789741   581 QTALKERLDALA-DLVDRLEAAADAREAAQRLAEKRAALAAQNEQRRDRLS----------------------------- 630
gi 169235456  581 QTALKERLDALA-DLVDRLEAAADAREAAQRLAEKRAALAAQNEQRRDRLS----------------------------- 630
gi 292655017  581 LDTLDDRRDRLD-RVESLVDTRAEKIDARDRLREKRETLAEVNRERREHLR----------------------------- 630
gi 222478619  585 LAAVDDAREAVA-AIEEQLSAIADAEDEIERRREKRENLNEVNDERRDRLA----------------------------- 634
gi 289582094  614 RSAIKETLQALR-RLREIADERAELERQIVTRRERRADWQEMNEERRETLS----------------------------- 663
gi 76801408   591 KADLDERRERLE-TVASLLADIAENESDIESLRERREHLTELNDQRRERLD----------------------------- 640
gi 284164775  585 RGEIKESLESLR-RIAEIDDERTELAAEVENRRERRDDWQTMNDERRETLS----------------------------- 634
gi 110667658  581 LETINNARDQLD-NLAEIQSEIENIRAEIERLRERREEIADRNDERREYLQ----------------------------- 630
                         810       820       830       840       850       860       870       880
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73667909   783 tkklganliqmdnikhkiseleasirnlaekvgffdreilERNERVKQLEGKLQGSRFEDLQSKRTQLEEYQANLTEK-T 861
gi 21228296   779 akklqanllrmqnikhkisefeagignlaekigffdreivERSDRIRQLEGKLEGNRLEELQQKLARFEEAQVNITEK-I 857
gi 15789741   631 ----------------------------------------ELRERKRTLDSEFDADRIETARADKDRAEDYLEQVEPK-L 669
gi 169235456  631 ----------------------------------------ELRERKRTLDSEFDADRIETARADKDRAEDYLEQVEPK-L 669
gi 292655017  631 ----------------------------------------ERRERRDELRETVDEEAVEGAKQRKKNAAAYLERVEDEvL 670
gi 222478619  635 ----------------------------------------DKRERRDELAEAVDEAAVDEARERKETAEEYLEKVDGE-L 673
gi 289582094  664 ----------------------------------------AKRDRKRELEDEFDDARVEAAREDRQNADTYIEQVEEK-L 702
gi 76801408   641 ----------------------------------------EKRTRKAELEAEFDDAAVTEAKAQKQRAEEYIDEVASY-L 679
gi 284164775  635 ----------------------------------------SKRERKRDLESEFDEERIETARGDKENAEQYIAKVDDK-L 673
gi 110667658  631 ----------------------------------------AKRDRHAELAADVNEARIEKAQNNHEEAVSYLEDVSEK-L 669
                         890       900       910       920       930       940       950       960
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73667909   862 RQTTAAKDALLKEVGMVENSLKRRNELKDELKALENRKQYLEAVYSNAEELESMYMRVRADMRNRNIGALSTLLNEMFSF 941
gi 21228296   858 REITAEKDTLLKEIGMIENSLKRLKELKEELKALENKRLYLEAVYNNADELENTYMRVRADMRARNIGALSILLNEMFSF 937
gi 15789741   670 QALREDRDDLQAKIGAAENAIAELESLREEHERVQSRHQDLQAVHDEVTALETMYGELRAELRQQNVSKLERLLNETFEL 749
gi 169235456  670 QALREDRDDLQAKIGAAENAIAELESLREEHERVQSRHQDLQAVHDEVTALETMYGELRAELRQQNVSKLERLLNETFEL 749
gi 292655017  671 PELREKRDDLQSRVGGVEAELEQLDDLRERRDHLAERVDALESVHDEVSTLESTYGDLRAELRQRNVEVLERMLNETFDL 750
gi 222478619  674 DRLAERRTELENAIGGVNSEIQELENLREERESLAERVDALEDLHEETSELEAMYGDLRAELRQRNVAELERTLNETFEL 753
gi 289582094  703 DDLEEQRDDVQGTIGGVEEKLDELERLRDRLVAVEETCETLESLYDEAETLQTTYGELRSDLRQQNVETLERLLNETFDL 782
gi 76801408   680 ETKREERDKLQSDIGAVKNELEELEALRERRDELEATVERLRTLRDEARTLQDTYADLRSELRQQNVERLEAMLNEIFEL 759
gi 284164775  674 EELEEKRTEIQNAIGAAERELEELEELRDRLDTVENRCDRLESLYDEAETLQATYADLRAELRQRNVETLERLLNETFDL 753
gi 110667658  670 DELRDKRDNIQSQIGSVRGEIENLAELREKHTAINDRVSALETLHEQVETLSSTYRELRADLRKQNVETLERMLNEVFML 749
                         970       980       990      1000      1010      1020      1030      1040
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73667909   942 MYTNNAYSHIELDPEYNLTVYRKDGTPLEPKLLSGGERAIFNLVLRCAIYRLLALGFGGDRAdgLPPMILDEPTVFLDRG 1021
gi 21228296   938 MYTNNAYSHIELDPEYNLTVYRKDGTPLEPKLLSGGERAIFNLVLRCAIYRLLALGFGGDRPdgLPPMILDEPTVFLDRG 1017
gi 15789741   750 VYQNDSYARIELSGEYELTVYQKDGEPLEPAQLSGGERALFNLSLRTAVYRLLAEGIEGDAP--LPPLILDEPTVFLDSG 827
gi 169235456  750 VYQNDSYARIELSGEYELTVYQKDGEPLEPAQLSGGERALFNLSLRTAVYRLLAEGIEGDAP--LPPLILDEPTVFLDSG 827
gi 292655017  751 VYANDAYSRIRLDGEYGLTVFQKDGTALEPEQLSGGERALFNLSLRCAIYRLLAEGIDGAAP--LPPLILDEPTVFLDGG 828
gi 222478619  754 VYGNDAYSHIELDGEYVLTVYQKDGEPLDPEQLSGGERALFNLSLRCAIYRLLSEGIEGAAP--TPPLILDEPTVFLDSG 831
gi 289582094  783 VYQNDSYAAIDLDGDYQLTVYQKDGESLDPEQLSGGERALFNLSLRCAIYRLLAEGVEGAAP--MPPLILDEPTVFLDSG 860
gi 76801408   760 VYQNDSYARIELDGDYELTVYQKDGTPLDPDQLSGGERAIFNLSLRCAIYRLLSEGIDGESP--TPPLILDEPTVFLDAG 837
gi 284164775  754 VYQNDSYAGIDLDGEYRLTVYQKDGEALEPEQLSGGERALFNLSLRCAIYRLLAEGVEGSAP--MPPLILDEPTVFLDSG 831
gi 110667658  750 IYDNDAYSRIQLDDAYELTIFQKDETALNPEQLSGGERALFNLSLRCAIYRLLAEGIDGTAP--MPPLILDEPTVFLDSG 827
                        1050      1060      1070      1080      1090
                  ....*....|....*....|....*....|....*....|....*....|...
gi 73667909  1022 HINQLLKLIDMMRGIGVGQIIVVSHDESLIDSADHVFQVEKDPITNMSSIVKL 1074
gi 21228296  1018 HVRQLLKLIDMMRSIGVGQIIVVSHDESLIDSADHVFQVEKDPLTNMSSITKI 1070
gi 15789741   828 HVSQLVELVESMRRLGVEQIVVVSHDDELVAAADDVVRVAKDATSNRSRVSTP 880
gi 169235456  828 HVSQLVELVESMRRLGVEQIVVVSHDDELVAAADDVVRVAKDATSNRSRVSTP 880
gi 292655017  829 HVSRLVDLVEDMQSRGVKQILIVSHDEDLVGAADDLVRVEKNPTTNRSTVERT 881
gi 222478619  832 HVSRLVRLVEEMRGFGVRQILIVSHDDELVGAADELVTVEKDPRTNRSTVRRE 884
gi 289582094  861 HVTQLVSLVESMRDLGVEQIVVVSHDQELVGAADSLVRVEKDATSNRSRLERG 913
gi 76801408   838 HVSKLVELVESMTDHGVEQIIVVSHDDELAGAADDLVAVRKNPTTNRSSVERS 890
gi 284164775  832 HVTQLVSLVESMRDLGVEQIVVVSHDEELVGAADSLVRVEKDATSNRSRLERG 884
gi 110667658  828 HVGRLVDLIKDMQRRGVAQILIVSHDKELIAAADHLVTVKKDPTSNRSSITRI 880
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap