Conserved Protein Domain Family
PRK02106

?
PRK02106: PRK02106 
choline dehydrogenase; Validated
Links
?
Statistics
?
PSSM-Id: 235000
Aligned: 227 rows
Threshold Bit Score: -1
Created: 9-Dec-2010
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
172040484  23 DSHRDVVIVGGGSAGSVLANRLTEDKDTKVMVLEAGRMDsfWDLFIHMPAAFAFPIGNKFYDWAYESEPEPEMNGRRIYH 102
119384631   1 -MIPDYVIVGAGSAGCALAYRLVM-AGKRVDIIEYGGSD--VGPFIQMPAALSYPMNMRRYDWGFSSEPEPHLGRRRLVT 76 
222147864   2 ENQADFIIIGSGSAGAAMAYRLSEDGKHTVIVLEFGGSD--IGPFVQMPAALAFPMNMDRYNWGYVTEPEPHLNNRRMIA 79 
77462733    1 --MFDYIIVGAGSAGCAMAYRLGE-AGRSVLVIEHGGTD--AGPFIQMPAALSYPMNMGIYDWGLKTEPEPHLDGRVLAT 75 
126461625   1 --MFDYIIVGAGSAGCAMAYRLGE-AGRSVLVVEHGGTD--AGPFIQMPAALSYPMNMGIYDWGLKTEPEPHLDGRVLAT 75 
146278345   1 --MFDYVIVGAGSAGCAMAYRLGE-AGRSVLVIEHGGTD--AGPFIQMPAALSYPMNMGIYDWGLKTEPEPHLGGRVLAT 75 
221638594   1 --MFDYIIVGAGSAGCAMAYRLGE-AGRSVLVVEHGGTD--AGPFIQMPAALSYPMNMGIYDWGLKTEPEPHLDGRVLAT 75 
56695985    1 -MEADFVIVGAGSAGCAMAYRLSG-AGASVLVIEHGGTD--AGPFIQMPAALSYPMNMSRYDWGYLSEPEPHLNNRRLVC 76 
99081723    1 -MNADYVIVGAGSAGCAMAYRLSE-AGKSVLVIEHGGTD--AGPFIQMPGALSYPMNMSMYDWGYKSQPEPHLGGRELVT 76 
110679306   1 -MQADFVIVGAGSAGCAMAYRLSE-AGASVIVIEHGGTD--AGPLIQMPAALSYPMNMKRYDWGYSSEPEPHLGGRRLAC 76 
119384631   1 -MIPDYVIVGAGSAGCALAYRLVM-AGKRVDIIEYGGSD--VGPFIQMPAALSYPMNMRRYDWGFSSEPEPHLGRRRLVT 76 
222147864   2 ENQADFIIIGSGSAGAAMAYRLSEDGKHTVIVLEFGGSD--IGPFVQMPAALAFPMNMDRYNWGYVTEPEPHLNNRRMIA 79 
77462733    1 --MFDYIIVGAGSAGCAMAYRLGE-AGRSVLVIEHGGTD--AGPFIQMPAALSYPMNMGIYDWGLKTEPEPHLDGRVLAT 75 
126461625   1 --MFDYIIVGAGSAGCAMAYRLGE-AGRSVLVVEHGGTD--AGPFIQMPAALSYPMNMGIYDWGLKTEPEPHLDGRVLAT 75 
146278345   1 --MFDYVIVGAGSAGCAMAYRLGE-AGRSVLVIEHGGTD--AGPFIQMPAALSYPMNMGIYDWGLKTEPEPHLGGRVLAT 75 
221638594   1 --MFDYIIVGAGSAGCAMAYRLGE-AGRSVLVVEHGGTD--AGPFIQMPAALSYPMNMGIYDWGLKTEPEPHLDGRVLAT 75 
56695985    1 -MEADFVIVGAGSAGCAMAYRLSG-AGASVLVIEHGGTD--AGPFIQMPAALSYPMNMSRYDWGYLSEPEPHLNNRRLVC 76 
99081723    1 -MNADYVIVGAGSAGCAMAYRLSE-AGKSVLVIEHGGTD--AGPFIQMPGALSYPMNMSMYDWGYKSQPEPHLGGRELVT 76 
110679306   1 -MQADFVIVGAGSAGCAMAYRLSE-AGASVIVIEHGGTD--AGPLIQMPAALSYPMNMKRYDWGYSSEPEPHLGGRRLAC 76 
172040484 103 ARGRVLGGSGSVNGMIYQRGNPMDYEKWGKLpGMENWDYAHVLPYFNKLETALa--aDPNDPRRGHDGPLKLTRG--PAt 178
119384631  77 PRGKVVGGSSSINGMVFVRGHARDFDFWAES-GAGGWAYADVLPYFKRMESSH----GAVSDYRGTEGPLHVTRGsrK-- 149
222147864  80 PRGKVVGGSSSINGMVYVRGHAEDFNRWDEL-GATGWSYADVLPYFKRMEHSH----GGEEGWRGTDGPLHVRRG--EVk 152
77462733   76 PRGKVIGGSSSINGMVYVRGHARDFDHWAES-GATGWGFADVLPYFKRMENWHv---PGDVEWRGHDGPLHVTRG--PRs 149
126461625  76 PRGKVIGGSSSINGMVYVRGHARDFDHWAES-GATGWGFADVLPYFKRMENWHv---PGDVEWRGHDGPLHVTRG--PRs 149
146278345  76 PRGKVIGGSSSINGMVYVRGHARDFDHWAEA-GAAGWGFAEVLPYFKRMENWHv---PGDVDWRGHDGPLHVTRG--PRs 149
221638594  76 PRGKVIGGSSSINGMVYVRGHARDFDHWAES-GATGWGFADVLPYFKRMENWHv---PGDVEWRGHDGPLHVTRG--PRs 149
56695985   77 PRGKVIGGSSSINGMVYVRGHAMDFDTWSEM-GADGWAYADVLPYFKRMETWHdgghGGDASWRGTDGPLHVTRG--PRt 153
99081723   77 PRGKVIGGSSSINGMVYVRGHAGDYNHWAET-GATGWSYADVLPYFKRMETWDdrghGGDPDWRGTDGPLHVTRG--PRd 153
110679306  77 PRGKVIGGSSSINGMVYVRGHAMDFDHWAEQ-GAEGWSYADVLPYYKRMENWHdgghGGDPAWRGTDGPLHVSRG--ARq 153
119384631  77 PRGKVVGGSSSINGMVFVRGHARDFDFWAES-GAGGWAYADVLPYFKRMESSH----GAVSDYRGTEGPLHVTRGsrK-- 149
222147864  80 PRGKVVGGSSSINGMVYVRGHAEDFNRWDEL-GATGWSYADVLPYFKRMEHSH----GGEEGWRGTDGPLHVRRG--EVk 152
77462733   76 PRGKVIGGSSSINGMVYVRGHARDFDHWAES-GATGWGFADVLPYFKRMENWHv---PGDVEWRGHDGPLHVTRG--PRs 149
126461625  76 PRGKVIGGSSSINGMVYVRGHARDFDHWAES-GATGWGFADVLPYFKRMENWHv---PGDVEWRGHDGPLHVTRG--PRs 149
146278345  76 PRGKVIGGSSSINGMVYVRGHARDFDHWAEA-GAAGWGFAEVLPYFKRMENWHv---PGDVDWRGHDGPLHVTRG--PRs 149
221638594  76 PRGKVIGGSSSINGMVYVRGHARDFDHWAES-GATGWGFADVLPYFKRMENWHv---PGDVEWRGHDGPLHVTRG--PRs 149
56695985   77 PRGKVIGGSSSINGMVYVRGHAMDFDTWSEM-GADGWAYADVLPYFKRMETWHdgghGGDASWRGTDGPLHVTRG--PRt 153
99081723   77 PRGKVIGGSSSINGMVYVRGHAGDYNHWAET-GATGWSYADVLPYFKRMETWDdrghGGDPDWRGTDGPLHVTRG--PRd 153
110679306  77 PRGKVIGGSSSINGMVYVRGHAMDFDHWAEQ-GAEGWSYADVLPYYKRMENWHdgghGGDPAWRGTDGPLHVSRG--ARq 153
172040484 179 SPLFQAFFRSVQEAGYNLTNDVNGYRQEGFAPFDRTIFHGKRHSAARAYLHPIMNRKNLDIRTRAFTTKILFedapaDgs 258
119384631 150 NPLFNAFIRAGREAGYPTTEDYNGARQEGFGAMEATIWEGRRWSAANAYLRPAQETGQLRLR-RGLAQRVVF-----E-- 221
222147864 153 NPLYQAFIDAGQQAGFPVTEDYNGRQQEGFGLMEQTSWQGRRWSTANAYLKPALKRDNCRLI-RCFARKIVL-----D-- 224
77462733  150 NPLFNAFIEAGRQAGYPVTDDYNGAAQEGFGPMEATIWQGRRWSAANAYLRPAMKRFGVQL-TRALALKVVI-----E-- 221
126461625 150 NPLFNAFIEAGRQAGYPVTDDYNGAAQEGFGPMEATIWQGRRWSAANAYLRPAMKRFGVQL-TRALALKVVI-----E-- 221
146278345 150 NPLFNAFIEAGRQAGYPVTDDYNGAAQEGFGPMEATIWQGRRWSAANAYLKPAMKRFGVKV-TRALALRVVI-----E-- 221
221638594 150 NPLFNAFIEAGRQAGYPVTDDYNGAAQEGFGPMEATIWQGRRWSAANAYLRPAMKRFGVKL-TRALALKVVI-----E-- 221
56695985  154 NPLFKAFVDAGKQAGYEVTGDYNGEKQEGFGPMEQTVWKGRRWSAANAYLKPALKRENCDIL-RGLAARVVM-----D-- 225
99081723  154 NPLHDAFVKSGQQAGYPVTKDYNGQQQEGFGPMEMTVHKGRRWSAANAYLKPALKRDNCDLI-RALARKVVI-----E-- 225
110679306 154 NPLFKAFVQAGIEAGYQATDDYNGHKQEGFGPMEQTVWRGRRWSAANAYLRPALKRDNCTLVNG-LAQRVIF-----E-- 225
119384631 150 NPLFNAFIRAGREAGYPTTEDYNGARQEGFGAMEATIWEGRRWSAANAYLRPAQETGQLRLR-RGLAQRVVF-----E-- 221
222147864 153 NPLYQAFIDAGQQAGFPVTEDYNGRQQEGFGLMEQTSWQGRRWSTANAYLKPALKRDNCRLI-RCFARKIVL-----D-- 224
77462733  150 NPLFNAFIEAGRQAGYPVTDDYNGAAQEGFGPMEATIWQGRRWSAANAYLRPAMKRFGVQL-TRALALKVVI-----E-- 221
126461625 150 NPLFNAFIEAGRQAGYPVTDDYNGAAQEGFGPMEATIWQGRRWSAANAYLRPAMKRFGVQL-TRALALKVVI-----E-- 221
146278345 150 NPLFNAFIEAGRQAGYPVTDDYNGAAQEGFGPMEATIWQGRRWSAANAYLKPAMKRFGVKV-TRALALRVVI-----E-- 221
221638594 150 NPLFNAFIEAGRQAGYPVTDDYNGAAQEGFGPMEATIWQGRRWSAANAYLRPAMKRFGVKL-TRALALKVVI-----E-- 221
56695985  154 NPLFKAFVDAGKQAGYEVTGDYNGEKQEGFGPMEQTVWKGRRWSAANAYLKPALKRENCDIL-RGLAARVVM-----D-- 225
99081723  154 NPLHDAFVKSGQQAGYPVTKDYNGQQQEGFGPMEMTVHKGRRWSAANAYLKPALKRDNCDLI-RALARKVVI-----E-- 225
110679306 154 NPLFKAFVQAGIEAGYQATDDYNGHKQEGFGPMEQTVWRGRRWSAANAYLRPALKRDNCTLVNG-LAQRVIF-----E-- 225
172040484 259 APKAIGAEYTWK-GKTRRVYADKVILCGGAFNTPQLLQLSGIGDKEHLSSLGIDVRKHLPGVGQNLQDHLEVYVQYNCTQ 337
119384631 222 DGRAVGVEVKNSrGVNVFRAKHEVILSASSINTPKLLMLSGIGPAEHLAEHGIAVRADRPGVGANLQDHLEVYMQYTATK 301
222147864 225 GRRAVGVEVEIGgKIEVIRANREVIVAASAFNSPKLLLLSGIGPAAHLREMGIDVVADRPGVGQNLQDHLEYYHQFKSKL 304
77462733  222 EGRAVGVEVQRRgGREVIRAGREVILAASSLNTPKLLMLSGIGSAAHLAEHGIPVVADRPGVGQNLQDHLEVYMQFASLQ 301
126461625 222 EGRAVGVEVQRRgGREVIRAGREVILAASSLNTPKLLMLSGIGSAAHLAEHGIPVVADRPGVGRNLQDHLEVYMQFASLQ 301
146278345 222 EGRAVGVEVQRRgRREVIRAGREVILAASSINTPKLLMLSGIGPAAHLAEHGLPVVADRPGVGRNLQDHLEVYMQYASLL 301
221638594 222 EGRAVGVEVQRRgGREVIRAGREVILAASSLNTPKLLMLSGIGAAAHLAEHGIPVVADRPGVGQNLQDHLEVYMQFASLQ 301
56695985  226 AGRATGVEIIRGgKAEVIRARREVIIAASSINSPKLLMLSGIGPAAHLAEHGIAVVADRPGVGANLQDHLELYIQQAAIQ 305
99081723  226 DGRAVGVEVERGgKIEVIRANIEVILAASSLNSPKLLMLSGIGPAAHLAEHGIDVIADRPGVGQNLQDHLEFYFQFASKK 305
110679306 226 GRRARGVEILQGgKTKVIHAAREVVLAASSINSPKLLMLSGVGPAGHLAEQGVDVIADRPGVGQNLQDHLELYLQMASKQ 305
119384631 222 DGRAVGVEVKNSrGVNVFRAKHEVILSASSINTPKLLMLSGIGPAEHLAEHGIAVRADRPGVGANLQDHLEVYMQYTATK 301
222147864 225 GRRAVGVEVEIGgKIEVIRANREVIVAASAFNSPKLLLLSGIGPAAHLREMGIDVVADRPGVGQNLQDHLEYYHQFKSKL 304
77462733  222 EGRAVGVEVQRRgGREVIRAGREVILAASSLNTPKLLMLSGIGSAAHLAEHGIPVVADRPGVGQNLQDHLEVYMQFASLQ 301
126461625 222 EGRAVGVEVQRRgGREVIRAGREVILAASSLNTPKLLMLSGIGSAAHLAEHGIPVVADRPGVGRNLQDHLEVYMQFASLQ 301
146278345 222 EGRAVGVEVQRRgRREVIRAGREVILAASSINTPKLLMLSGIGPAAHLAEHGLPVVADRPGVGRNLQDHLEVYMQYASLL 301
221638594 222 EGRAVGVEVQRRgGREVIRAGREVILAASSLNTPKLLMLSGIGAAAHLAEHGIPVVADRPGVGQNLQDHLEVYMQFASLQ 301
56695985  226 AGRATGVEIIRGgKAEVIRARREVIIAASSINSPKLLMLSGIGPAAHLAEHGIAVVADRPGVGANLQDHLELYIQQAAIQ 305
99081723  226 DGRAVGVEVERGgKIEVIRANIEVILAASSLNSPKLLMLSGIGPAAHLAEHGIDVIADRPGVGQNLQDHLEFYFQFASKK 305
110679306 226 GRRARGVEILQGgKTKVIHAAREVVLAASSINSPKLLMLSGVGPAGHLAEQGVDVIADRPGVGQNLQDHLELYLQMASKQ 305
172040484 338 PVSSQPYYKMWMRPIIGLQWLLTRRGPVASSHFEAGGFARSNENEDYPNLMFHFLPMAIRYDGSQPEGEHGFQFHVGPMY 417
119384631 302 PITLYKHWNLWGKGSIGAQWLATGTGLGASNQFESCGFIRSAAGVEYPDIQYHFLPLAVRYDGKAAAEGHGFQVHVGPMR 381
222147864 305 PITLHSKNNWFWKGVVGAQWLLFKKGLGTSNQFEAAAFIRSSAGVKWPDLQYHFLPIAVSYDGKSSVEGHGFQAHVGYNM 384
77462733  302 PVTLFKHWNLRGKVSIGAQWLFTGRGLGASNQFEACAFIRSKPGVEYPDIQYHFLPIAVRYDGKAAAEGHGFQVHVGPMR 381
126461625 302 PVTLFKHWNLRGKVSIGAQWLFTGRGLGASNQFEACAFIRSKPGVDYPDIQYHFLPIAVRYDGKAAAEGHGFQVHVGPMR 381
146278345 302 PVTLFKHWNLRGKVMVGAQWLFTGRGLGASNQFEACAFIRSRPGVDYPDIQYHFLPIAVRYDGKAAAEGHGFQVHVGPMR 381
221638594 302 PVTLFKHWNLRGKVSIGAQWLFTGRGLGASNQFEACAFIRSKPGVDYPDIQYHFLPIAVRYDGKAAAEGHGFQVHVGPMR 381
56695985  306 PVTLYKYWNLLGKAAIGAQWLFTKTGLGASNQFESAAFIRSQPGVPYPDIQYHFLPIAVRYDGQAAAEGHGFQAHVGPMR 385
99081723  306 PITLYKYWNLFGKALVGAQWLFTKTGLGASNQFESAAFIRSDKGIDYPDIQYHFLPIAVRYDGQAAAEGHGFQAHVGPMR 385
110679306 306 PITLYRYWNLFSKAVIGAQWLFTKTGMGSSNQFESAAFIRSKAGVPYPDVQYHFLPIAVRYDGKVAAEGHGFQAHVGPMR 385
119384631 302 PITLYKHWNLWGKGSIGAQWLATGTGLGASNQFESCGFIRSAAGVEYPDIQYHFLPLAVRYDGKAAAEGHGFQVHVGPMR 381
222147864 305 PITLHSKNNWFWKGVVGAQWLLFKKGLGTSNQFEAAAFIRSSAGVKWPDLQYHFLPIAVSYDGKSSVEGHGFQAHVGYNM 384
77462733  302 PVTLFKHWNLRGKVSIGAQWLFTGRGLGASNQFEACAFIRSKPGVEYPDIQYHFLPIAVRYDGKAAAEGHGFQVHVGPMR 381
126461625 302 PVTLFKHWNLRGKVSIGAQWLFTGRGLGASNQFEACAFIRSKPGVDYPDIQYHFLPIAVRYDGKAAAEGHGFQVHVGPMR 381
146278345 302 PVTLFKHWNLRGKVMVGAQWLFTGRGLGASNQFEACAFIRSRPGVDYPDIQYHFLPIAVRYDGKAAAEGHGFQVHVGPMR 381
221638594 302 PVTLFKHWNLRGKVSIGAQWLFTGRGLGASNQFEACAFIRSKPGVDYPDIQYHFLPIAVRYDGKAAAEGHGFQVHVGPMR 381
56695985  306 PVTLYKYWNLLGKAAIGAQWLFTKTGLGASNQFESAAFIRSQPGVPYPDIQYHFLPIAVRYDGQAAAEGHGFQAHVGPMR 385
99081723  306 PITLYKYWNLFGKALVGAQWLFTKTGLGASNQFESAAFIRSDKGIDYPDIQYHFLPIAVRYDGQAAAEGHGFQAHVGPMR 385
110679306 306 PITLYRYWNLFSKAVIGAQWLFTKTGMGSSNQFESAAFIRSKAGVPYPDVQYHFLPIAVRYDGKVAAEGHGFQAHVGPMR 385
172040484 418 SDTSGHVKIKSTDPHEKPEILFNYLKTEQDRREWVEAIKVSRELLDTDAMREFTDGEISPGAAVQTDEEILEWVRNDAET 497
119384631 382 SKSRGTVRLKSADPRQAPEIRFNYMSHPDDWAEFRACVRLTREIFEQPAFAEYKGYEIQPGEEVVSDEQIDAFIREHAES 461
222147864 385 SKSRGSVTLRSPDVKDAPVLRFNYMSDAEDWVKFRHAVRITRDIFAQKAFDPYRESEIAPGSKVQTNDEIDAFLREHLEG 464
77462733  382 SPSRGSVTLRSADPEAPPVIRFNYMSTEEDWQDFRRCVRLTREIFGQEAFKPFVRHEIQPGAACASDAEIDAFIREHVES 461
126461625 382 SPSRGSVTLRSADPEAPPVIRFNYMSTEEDWQDFRRCVRLTREIFGQEAFKPFVRHEIQPGAACASDAEIDAFIRAHVES 461
146278345 382 SPSRGSVTLRSADPEAAPVIRFNYMSTPEDWEDFRRCIRLTREIFGQEAFRPFVKGEIQPGPACQSDDEIDAFIREHVES 461
221638594 382 SPSRGSVRLRSADPEAPPVIRFNYMSTEEDWQDFRRCVRLTREIFGQEAFKPFVRHEIQPGSACASDAEIDAFIREHVES 461
56695985  386 SPSRGAVTLRSDRPEDAPVIRFNYMSHEKDWADFRTCIRLTREIFGQDAFKPYAGKEIQPGAAVQSDEELNAFIAEHAES 465
99081723  386 SQSRGEVTLASADPNAAPKILFNYMSTEQDWIDFRKCVRLTREIFAQDAMKPFVKHEIQPGTDLQTDEEIDGFLREHVES 465
110679306 386 SKSRGSVTLASPDPAEAPKITFNYMSHADDWEDFRRCIRLTREIFAQDAFKPFVKHEIQPGAAVQSDDALNDFISEHVES 465
119384631 382 SKSRGTVRLKSADPRQAPEIRFNYMSHPDDWAEFRACVRLTREIFEQPAFAEYKGYEIQPGEEVVSDEQIDAFIREHAES 461
222147864 385 SKSRGSVTLRSPDVKDAPVLRFNYMSDAEDWVKFRHAVRITRDIFAQKAFDPYRESEIAPGSKVQTNDEIDAFLREHLEG 464
77462733  382 SPSRGSVTLRSADPEAPPVIRFNYMSTEEDWQDFRRCVRLTREIFGQEAFKPFVRHEIQPGAACASDAEIDAFIREHVES 461
126461625 382 SPSRGSVTLRSADPEAPPVIRFNYMSTEEDWQDFRRCVRLTREIFGQEAFKPFVRHEIQPGAACASDAEIDAFIRAHVES 461
146278345 382 SPSRGSVTLRSADPEAAPVIRFNYMSTPEDWEDFRRCIRLTREIFGQEAFRPFVKGEIQPGPACQSDDEIDAFIREHVES 461
221638594 382 SPSRGSVRLRSADPEAPPVIRFNYMSTEEDWQDFRRCVRLTREIFGQEAFKPFVRHEIQPGSACASDAEIDAFIREHVES 461
56695985  386 SPSRGAVTLRSDRPEDAPVIRFNYMSHEKDWADFRTCIRLTREIFGQDAFKPYAGKEIQPGAAVQSDEELNAFIAEHAES 465
99081723  386 SQSRGEVTLASADPNAAPKILFNYMSTEQDWIDFRKCVRLTREIFAQDAMKPFVKHEIQPGTDLQTDEEIDGFLREHVES 465
110679306 386 SKSRGSVTLASPDPAEAPKITFNYMSHADDWEDFRRCIRLTREIFAQDAFKPFVKHEIQPGAAVQSDDALNDFISEHVES 465
172040484 498 ALHPSCTAKMGSadDEMAVVDPESmQVHGVEGLYVVDASAMPIVTNGNIYSPVLMLAEKAADLIRGRKPEAPINVPFYQa 577
119384631 462 AFHPCGTARMGRadDPMAVVDPEL-RVIGVEGLRVADSSIFPRITNGNLNAPSIMTGEKAADHILGQGMLAPLNLGPEI- 539
222147864 465 AYHPCGTAKMGSkdDPMAVVDPTC-KVIGVEGLRVADSSIFPHVTYGNLNGPSIMTGEKASDHILGRDPLPRSNQEPWI- 542
77462733  462 AYHPCGTARIGRadDPMAVVDPEC-RVIGVEGLRVADSSIFPRVTNGNLNAPSIMVGEKASDHILGRTPLAPLNLEPVT- 539
126461625 462 AYHPCGTARIGRadDPMAVVDPEC-RVIGVEGLRVADSSIFPRVTNGNLNAPSIMVGEKASDHILGRTPLAPLNLEPVT- 539
146278345 462 AYHPCGTARMGRadDPMAVVDPEC-RVIGVAGLRVADSSIFPRVTNGNLNAPSMMVGEKAADHVLGRTPLAPLNHEPVV- 539
221638594 462 AYHPCGTARIGRadDPMAVVDPEC-RVIGVEGLRVADSSIFPRVTNGNLNAPSIMVGEKAADHILGRTPLAPLNLEPVM- 539
56695985  466 AYHPCGSCRMGRasDRNAVVDGQG-RVIGVEGLRVADSSIFPQITNGNLNAPSIMVGEKMSDHILGRDPLPRANDIPWI- 543
99081723  466 AYHPCGTCKMGAvdDPMAVVDPEC-RVIGVEGLRVADSSIFPRITNGNLNGPSIMTGEKASDHILGRR-LPSSNAEPWF- 542
110679306 466 AYHPCGTCRMGRadDPQAVVDPQA-RVIGVEGLRVADSSIFPRITNGNLNAPSIMVGEKVSDHLLGKDTLARSNDRAWI- 543
119384631 462 AFHPCGTARMGRadDPMAVVDPEL-RVIGVEGLRVADSSIFPRITNGNLNAPSIMTGEKAADHILGQGMLAPLNLGPEI- 539
222147864 465 AYHPCGTAKMGSkdDPMAVVDPTC-KVIGVEGLRVADSSIFPHVTYGNLNGPSIMTGEKASDHILGRDPLPRSNQEPWI- 542
77462733  462 AYHPCGTARIGRadDPMAVVDPEC-RVIGVEGLRVADSSIFPRVTNGNLNAPSIMVGEKASDHILGRTPLAPLNLEPVT- 539
126461625 462 AYHPCGTARIGRadDPMAVVDPEC-RVIGVEGLRVADSSIFPRVTNGNLNAPSIMVGEKASDHILGRTPLAPLNLEPVT- 539
146278345 462 AYHPCGTARMGRadDPMAVVDPEC-RVIGVAGLRVADSSIFPRVTNGNLNAPSMMVGEKAADHVLGRTPLAPLNHEPVV- 539
221638594 462 AYHPCGTARIGRadDPMAVVDPEC-RVIGVEGLRVADSSIFPRVTNGNLNAPSIMVGEKAADHILGRTPLAPLNLEPVM- 539
56695985  466 AYHPCGSCRMGRasDRNAVVDGQG-RVIGVEGLRVADSSIFPQITNGNLNAPSIMVGEKMSDHILGRDPLPRANDIPWI- 543
99081723  466 AYHPCGTCKMGAvdDPMAVVDPEC-RVIGVEGLRVADSSIFPRITNGNLNGPSIMTGEKASDHILGRR-LPSSNAEPWF- 542
110679306 466 AYHPCGTCRMGRadDPQAVVDPQA-RVIGVEGLRVADSSIFPRITNGNLNAPSIMVGEKVSDHLLGKDTLARSNDRAWI- 543
172040484 578 kkdmplYAEGEQ 589
119384631 540 ------SPDWEK 545
222147864 543 ------NPDWQL 548
77462733  540 ------NPNWRT 545
126461625 540 ------NPNWRT 545
146278345 540 ------NPNWRV 545
221638594 540 ------NPNWRT 545
56695985  544 ------NPRWEA 549
99081723  543 ------NPNWQT 548
110679306 544 ------HPDWQT 549
119384631 540 ------SPDWEK 545
222147864 543 ------NPDWQL 548
77462733  540 ------NPNWRT 545
126461625 540 ------NPNWRT 545
146278345 540 ------NPNWRV 545
221638594 540 ------NPNWRT 545
56695985  544 ------NPRWEA 549
99081723  543 ------NPNWQT 548
110679306 544 ------HPDWQT 549
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap