Conserved Protein Domain Family
PRK02039

?
PRK02039: PRK02039 (this model, PSSM-Id:100969 is obsolete)
ribose-phosphate pyrophosphokinase; Provisional
Statistics
?
PSSM-Id: 100969
View PSSM: PRK02039
Aligned: 26 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 22-Jul-2008
Updated: 31-Jul-2008
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33594046    1 MANDSFMIFTGTANTRLAVDVVNHLDMSLGKMTVGRYSDGEVMVEINENVRGKDVFVLQPTCAPTNDNLMEIMVMVDALR 80
gi 33599890    1 ------MIFTGTANTRLAVDVVNHLDMSLGKMTVGRFSDGEVMVEINENVRGKDVFVLQPTCAPTNDNLMEIMVMVDALR 74
gi 33595505    1 ------MIFTGTANTRLAVDVVNHLDMSLGKMTVGRFSDGEVMVEINENVRGKDVFVLQPTCAPTNDNLMEIMVMVDALR 74
gi 78067601    4 HSHDGLMVFTGNANPALAQEVVNILGIPLGKAMVSRFSDGEIQVEIQENVRGKDVFVLQSTCAPTNDNLMELMIMVDALK 83
gi 91781713    2 SSHDGLMVFTGNANPALAQEVVKILGIPLGKAMVSRFSDGEIQVEIQENVRGKDVFVLQSTCAPANDNLMELMIMVDALK 81
gi 113866402   1 MSSEGLMVFTGNANPKLAEAVVQHLGIPLGKALVGRFSDGEVQVDIQENVRGKHVIVLQSTCAPTNDNLMELMVMVDALK 80
gi 73540048    1 MSSEGLMVFTGNANPKLAEAVVQHLGIPLGKALVGRFSDGEVQVEIQENVRGKHVIVLQSTCAPTNDNLMELMVMVDALK 80
gi 94309234    1 MSVEGLMVFTGNANPKLAEAVVQHLGIPLGKALVGRFSDGEVQVEIQENVRGKHVIVLQSTCAPTNDNLMELMVMVDALK 80
gi 134096053   1 MALENLMVFTGNANPDLALGVAKHLGIPLGKAVVSKFSDGEIVVEINENVRGKDVFVLQSTCAPTNDNLMEIMLMVDALK 80
gi 152980563   1 MALENLMVFTGNANPDLALGVAKQLGLPLGKAVVSKFSDGEIVVEINENVRGKDVFVLQSTCAPTNDNLMEIMLMVDALK 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33594046   81 RASAGRITAAIPYFGYARQDRRPRSARVAISAKVVANMLQVAGVDRVLTMDLHADQIQGFFDIPVDNIYAGPILLGDIWR 160
gi 33599890   75 RASAGRITAAIPYFGYARQDRRPRSARVAISAKVVANMLQVAGVDRVLTMDLHADQIQGFFDIPVDNIYAGPILLGDIWR 154
gi 33595505   75 RASAGRITAAIPYFGYARQDRRPRSARVAISAKVVANMLQVAGVDRVLTMDLHADQIQGFFDIPVDNIYAGPILLGDIWR 154
gi 78067601   84 RASAGRITAAIPYFGYARQDRRPRSARVAISAKVVANMLEIAGVERIITMDLHADQIQGFFDIPVDNIYATPILLGDLRK 163
gi 91781713   82 RASAGRITAAIPYFGYARQDRRPRSARVAISAKIVANMLEIAGVERIITMDLHADQIQGFFDIPVDNIYATPVLLGDLRK 161
gi 113866402  81 RASARSITAAMPYFGYARQDRRPRSARVAISAKVVANMLEVAGVERVLTMDLHADQIQGFFDIPVDNIYASPVLLGDLRE 160
gi 73540048   81 RASARSITAAMPYFGYARQDRRPRSARVAISAKVVANMLEVAGVERVLTMDLHADQIQGFFDIPVDNIYASPVLLGDLRE 160
gi 94309234   81 RASARSITAAMPYFGYARQDRRPRSARVAISAKIVANMLEVAGVERVLTMDLHADQIQGFFDIPVDNIYASPVLLGDLRE 160
gi 134096053  81 RASAGRITAAIPYYGYARQDRRPRSARVAISAKVVANMLQEAGVERVLIMDLHADQIQGFFDIPVDNIYASPILLSDLVA 160
gi 152980563  81 RASAGRITAAIPYYGYARQDRRPRSARVAISAKVVANMLQEAGVERVLIMDLHADQIQGFFDIPVDNIYASPILLRDLVT 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33594046  161 RNFSNLVVVSPDIGGVVRARALAKQLEADLAIIDKRRPRANVSEVMNIIGEVDGRTCIIMDDMVDTAGTLCKAAQALKDR 240
gi 33599890  155 RNFSNLVVVSPDIGGVVRARALAKQLEADLAIIDKRRPRANVSEVMNIIGEVDGRTCIIMDDMVDTAGTLCKAAQALKDR 234
gi 33595505  155 RNFSNLVVVSPDIGGVVRARALAKQLEADLAIIDKRRPRANVSEVMNIIGEVDGRTCIIMDDMVDTAGTLCKAAQALKDR 234
gi 78067601  164 QNYSDLLVVSPDVGGVVRARALAKQLNCDLAIIDKRRPKANVSEVMNIIGEVEGRTCVIMDDMVDTAGTLCKAAQVLKER 243
gi 91781713  162 QNYENLLVVSPDVGGVVRARALAKQLNCDLAIIDKRRPKANVAEVMNIIGEVEGRTCVIMDDMVDTAGTLCKAAQVLKER 241
gi 113866402 161 KNYGDLLVVSPDVGGVVRARALAKELNCDLAIIDKRRPKANVAEVMNIIGEVDGRNCVIMDDMIDTGGTLCKAAQVLKER 240
gi 73540048  161 KNYGNLLVVSPDVGGVVRARALAKELNCDLAIIDKRRPKANVAEVMNIIGEVDGRNCVIMDDMIDTGGTLCKAAQVLKER 240
gi 94309234  161 KNYGNLLVVSPDVGGVVRARALAKQLDCDLAIIDKRRPKANVSEVMNIIGEVAGRNCVIMDDMIDTGGTLCKAAQVLKER 240
gi 134096053 161 KNYDDLLVVSPDVGGVVRARALAKRMNCDLAIIDKRRPKANVSEVMNIIGEVEGRNCVIMDDMVDTAGTLTKAAEVLKER 240
gi 152980563 161 KNHEDLLVVSPDVGGVVRARALAKRLNCDLAIIDKRRPKANVSEVMNIIGEVEGRNCVIMDDMVDTAGTLTKAAEVLKER 240
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 33594046  241 GAGAVYAYCTHPVLSGGAIERIETSSLDELVVTDTIPLSEQAQACGKIRQLSCAALLGETILRISNAESVSSLFAD 316
gi 33599890  235 GAGAVYAYCTHPVLSGGAIERIETSSLDELVVTDTIPLSEQGQACGKIRQLSCAALLGETILRISNAESVSSLFAD 310
gi 33595505  235 GAGAVYAYCTHPVLSGGAIERIETSSLDELVVTDTIPLSEQGQACGKIRQLSCAALLGETILRISNAESVSSLFAD 310
gi 78067601  244 GAKQVFAYATHPVLSGGAGDRIAASALDELVVTDTIPLSAESLGCSKIRALTSASLLAETFSRIRRGDSVMSLFAE 319
gi 91781713  242 GAKQVFAYATHPVLSGGAGERIAASALDELVVTDTIPLGEEARSCAKIRSLTSAGLLAETFSRIRRGDSVMSLFAE 317
gi 113866402 241 GALKVFAYCTHPVLSGGAAARIADSALDEVVVCDTIPLSEEAAKCTKIRQLSTAPLLAETFTRIVKGDSIMSLFAG 316
gi 73540048  241 GAQKVFAYCTHPVLSGGAAARIADSALDEVVVCDTIPLSEEAAKCGKIRQLSTAPLLAETFTRIVKGDSIMSLFAG 316
gi 94309234  241 GAQKVFAYCTHPVLSGGAVARIAASALDEVVVCDTIPLSDEARQTGKIRQVTTAPLLAETFTRIVRGDSIMSLFAD 316
gi 134096053 241 GAKKVVAYCTHPVLSGPAIERITNSPLDELVVTDTIPLTDAAKACPKIRVLSCASLLAETFKRISTGDSVMSMFAE 316
gi 152980563 241 GAKKVIAYCTHPVLSGPAIERITTSPLDELVVTDTIPLTEAAKACPKIRVLSCAELLAETFKRISTGDSVMSMFAD 316
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap