Conserved Protein Domain Family
mnmC

?
PRK01747: mnmC 
bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed
Statistics
?
PSSM-Id: 234978
View PSSM: PRK01747
Aligned: 189 rows
Threshold Bit Score: 618.785
Threshold Setting Gi: 222823627
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218708896  28 ITNAELEWNeSGTPVSDQFDDVYFSNVNGLEETRYVFLKQnhlperWveHQQRRFVIAETGFGTGLNFLAVWQWFdaflk 107
gi 71908463    4 LQPARLEFVaYDTPYSAAFDDVYHSALGGPAQARHVFLAGnelparW--QDKYRFVILETGFGTGLNFLATWQAW----- 76
gi 186477810   5 LVPAVLAFRdNGTPYSPLYDDIYHSAVGGLAQADYVFLKGndlpsrW--QKRRLFTVLETGFGMGINFLVTWAAW----- 77
gi 187925901   5 LIPAVLVFRdNGTPFSPLYDDIYHSAVGGLEQARYVFLRGnslpdrW--QGRRIFTVLETGFGMGINFLMTWAAW----- 77
gi 217970369   3 IHPARLERTpEGVLYSGAFGDVYHSRDNALGQAHAVFIAGnglpqrW--QGRERFTIVETGFGAGLNFLATWAAW----- 75
gi 226939885   3 IQPAPLQFRsDGTPFSPVFDDVYHSADGGPGQSREVFLHGnnlpaaW--QGQAVFTMLETGFGPGLNFLTTLAAW----- 75
gi 295678171   5 LIPAVLAFRdNGSPFSPHYDDIYHSAVGALEQAQYVFLRGnelperW--QSRRTFTVLETGFGIGINFLVTWAAW----- 77
gi 56479346    3 IDPARLAFTdDGTPCSAAFGDVYHARGGGLEQARFVFIAGnglparW--QGREHFAILETGFGFGLNFLATWDAW----- 75
gi 91785773    5 LIPAVLAFRaNGTPFSPLYDDIYHSAVGGLEQAHYVFLRGnalperW--QERRVFTVVETGFGMGINFLVTWAAW----- 77
gi 119897773   3 ITPASLSFAeDGTPYSTAYGDVYHSSDGGLGQAHHVFLAGnglperW--RGRERFVIVETGFGLGLNFLASWAAW----- 75
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218708896 108 DNPQAMTKELHFISFEKYPLNKDDLIKAHQS---WPE---LAQYATQLQEHYPIALPECHRIVLGDgaITLDLWFGDIkD 181
gi 71908463   77 RDDPQRCRRLHFISFEKHPFTLADLATCQQA---WPE---FAELAAELQQKWPPLVPGMHRLHLNDgqVILTLTFGDAaT 150
gi 186477810  78 RADPDRCERLHFVSTEKHPFSREDLIAATNS---SVAdasIAALAEQLANAWPTLVPGTHRLEFEEgrVILTLVFGDAvQ 154
gi 187925901  78 RADPLRCERLHFVSTEKHPFTVGDLRKAVAAtisDPE---IAALAQALANAWPTLVPGTHRLEFDEgrVVLTLVFGDAqE 154
gi 217970369  76 REDACRSARLHFVSCELHPFCREDLARIHAA---WPE---LATFAAELRAQWPVLAPGLHRLNLDAgrVTLTLFLGDAaD 149
gi 226939885  76 RADPQRCQRLHFISVEKFPFTRDSLQHLHAQ---WPG---FAREAADLQARWPVLTPGFHRLTFDEgrVVLTLLLGDAqT 149
gi 295678171  78 RADPARCERLHFVSTEKHPFSAADLRRVHAStisDPL---IAELADTLANAWPMLVPGTHRLEFEGgrVVLTLIFADAlD 154
gi 56479346   76 RADPKRCERLHFVSVERHPFTREDLATLHAR---WPE---LAPLAAELADHWPTLTPGMHRLHLNRgrVVLTLLFGDArE 149
gi 91785773   78 RADSSRCERLHFVSTEKHPFTVDDLRKVYAAtisDPE---IAALAQALADAWPMLVPGTHRLEFEEgrVVLTLVFADAqD 154
gi 119897773  76 RKDPQRSERLHFVSCELHPFRVEDLALLHAR---WPE---FAPLAAELQANWPCLAPGVHRLHLDGgrVCLTLYFGDArD 149
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218708896 182 CMPNVPtprkGLVDAWFLDGFAPSKNPEMWNQNLFNGMAKLAKQDCSCATFTAAGFVRRGLIEAGFAMKKVKGFgTKREM 261
gi 71908463  151 QLRSID----ASVDAFFLDGFSPPKNPELWSPHFCKGLARLTAPGATLATWSVAGHVRQALKDAEFDVAKRPGYiGKRQM 226
gi 186477810 155 TLPTLW----LRADAFYLDGFSPDRNPDLWTPAVFKSLARLAGDEATFATYTSSGDVKRSLQQAGFEYRKVDGFgWKRAM 230
gi 187925901 155 RLPALR----LRADAFYLDGFAPARNPELWTPMIFKALARLAGEGATFATCSSAGDIKRALIQCGFEYRKVDGFgWKRAM 230
gi 217970369 150 GLARID----ARADALYLDGFAPAKNPALWSERVFHLLAGLAAPDATLATWSVAGQVREGLRRAGFTTEKAPGFgTKWQM 225
gi 226939885 150 LLPQLV----ARVDAFYLDGFSPAKNPELWSPALFRTLARLARPQATLATYTSAGFVRRGLIDAGFAVERRPGFgGKRQM 225
gi 295678171 155 SLPALR----LRADAFYLDGFAPAKNPELWSPAVFKALARVAGDDATFSTYSSAGDVKRALTQCGFEYRKVDGFgWKRAM 230
gi 56479346  150 LLPRLE----CGADAFFLDGFSPACNPELWSAALLAELGRLAASGATLATWSVSGDVRRALAAAGFDCEKAPGFdGKRQM 225
gi 91785773  155 SVPALR----LRADAFYLDGFAPARNPELWTSAIFKALARLAGEGATFATYSSAGDIKRALTQCGFEYRKVDGFgWKRAM 230
gi 119897773 150 GLAQLD----ARADAFLLDGFSPAKNPDLWSARIFHLLARLAAADATLATWSVAGEVREGLRRAGFEVEKAPGFgGKRQM 225
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218708896 262 IAGRL---DEKLAHTNIKPWYGlaQ--HSDS--------QDIAIIGGGVASAALAKTLNRRGKNITLYCEHQQAAGNASG 328
gi 71908463  227 LVGRF-------------------R--SRRPdrhvaptdRRAIVIGAGIAGSSTAHALAAAGWQVTVLEQATAPATGASS 285
gi 186477810 231 LVGRF------------APRYRvrR--HEPPlpla-vgeRHAIVIGTGLAGCAAIERLTARGWRVTSLERHADVARDASG 295
gi 187925901 231 LVGHF-----------APRWRV--R--RHEPpaplavdeRHAVVIGAGLAGCAVIERLAARGWRVTSLERHASVAQEASG 295
gi 217970369 226 LRGRLareARPLAVPEAA---------TSG---------RHALVLGAGIAGCTVAERLAGRGWTVELIDRAPAPATGASG 287
gi 226939885 226 LGGVY----ARQTPVRQPCWSR-----------------QEALVIGAGLAGAAAAERLAARGWQVTVLERESAPAQRASG 284
gi 295678171 231 LVGRF-----------APRWRV--R--RYEPpapfghdeRHAVVIGAGLAGCAVIERLAARGWRVTSLERHGSVAQDASG 295
gi 56479346  226 CRGRH-------------------RdvGTGPapaa-aaaRHALVIGAGLAGSSTAERLAARGWHVDVIDAADGPGEGASG 285
gi 91785773  231 LVGRF-----------APRWRV--R--RHEPpaplvvdeRHAVVIGTGLAGCAVIERLAARGWRVTSLERHAAVAQEASG 295
gi 119897773 226 LRGRYl--GRGHr-----PAPA-----AAE---------RRALVIGAGVAGTSIAERLAARGWQVELLDAASGPAQGASG 284
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218708896 329 NNQGAIYPLLSEATSNVSRIFGPGLLFARQFINqaa-qsVNFDHNWCGVNILMWDEGSTKKLnrmlegnfh-tdliqrlt 406
gi 71908463  286 NLAGMLRPLPSADDNRLSRITRAGFLATRALLAal----pEARWSPCGVLHLAREPEHEGQQrraveqlgfppevlqfve 361
gi 186477810 296 NPAGVFHPMMSRDDSVGSRITRAGFLYALRQWSalehrgHRPLRGPEGLLQIAADEEEALAMahtfasfawpreyvvsvt 375
gi 187925901 296 NPAGVFHPMISRDDSIASRVTRAGFLYTLRRWAalerlgHAPLRGGQGLLQIAADENEARSIseaiaafgypgdyvtpvs 375
gi 217970369 288 NLAGVLRPLPSLDDNRMSRLTRAGSLYAWRRIHqlrargLALRADDCGVLHLGRDAAQEVKMravverlalppehlrfvg 367
gi 226939885 285 NHVGVLLPVLSLDDNLQARLARTGFLYALSRFAel----pAFEHGQCGVLQLARDDEQAALQrrvietagfpegyarwmd 360
gi 295678171 296 NPAGVFHPMISRDDSVASRVTRAGFLYALNRWAalesagHRLARGDRGLLQIAADDDEARAIgeaiatfrypsdyvtpva 375
gi 56479346  286 NLTGVLRPLPSLDDNRLARITRAGALYGLHHLRqlteagLPVRWDACGVLHLARDPVHEDKQrrvveahrppsdylrfve 365
gi 91785773  296 NPAGVFHPMISRDDSVASRVTRTGFLYSLRHWAalerlgYGPSRGSKGLLQIAADDEEALSIsqaiaaasypseyvtsvp 375
gi 119897773 285 NHAGVLRPLPSLDDNRMGRLTRAGTLYGWRHIQrlqaagLPLRAEACGVLHLARDAAQEAKMravverlalppahlrfvs 364
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218708896 407 pEQANEKIGLPVDKESVYFPLGGWLSPLQLTQGLIGRLEetnqVSAHYQHQVTQLewLETEQQWLltIETPQGEIQtKHD 486
gi 71908463  362 sDEASRLLGQPVTIGGWWFPNGGWVQPPSVCRAALAAFPe--rITTHFNAAVARI--VRQNDQWQa-LDANGNLLA-EAP 435
gi 186477810 376 rDDAERIANMRVARGGWLFPHGGWIDPASLCAAQCEAAGg--lLERRFNVAAARV--ERLENQWIv-FDENGAAVV-SAP 449
gi 187925901 376 aAEAQRLAGMPLARGGWFFPHGGWIDPASLCAAQCAAAGp--lLERRFGVDVARI--ERSGGQWTv-FDTSGEAIA-RAP 449
gi 217970369 368 vDEAAEIAGCAVANGGWWFAGSGWVQPPSLCAASLEAAGg--rLRGHFGHTVARL--GYDGGAWHa-HGPDGSTIA-SAP 441
gi 226939885 361 aAEASVLAGARVPTSGWWFAQGSWIHPPAYCRSQLNAHGp--lIRVLTRAAAAQLerDPGSGDWVa-RDAAGTELA-RAP 436
gi 295678171 376 aADAARLAGMPLARGGWFFPRGGWIDPASLCAAQFASAGg--lLERRFGVDVARL--ERCGDRWTv-FDIAGKVVA-RAP 449
gi 56479346  366 rDEASTLAGWPLPVGGWWFPQGAWVSPPSLCAANLMTHPd--lIRCHFGRAMQRL--EASADGWTa-FDADGKAIA-SAP 439
gi 91785773  376 aDEAQRLAGMPLAHGGWFFPYGGWIDPASLCAAQCAAAGp--lLERRFGVDVARI--ERAGGQWIv-FDTAGQVVA-RAP 449
gi 119897773 365 aAEASEIGGWPVPLGGWWFGDSGWVQPPSLCAANLSAGGe--gIRAHWNARVTL---ARADTRWQa-RDAQGALLA-EAP 437
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218708896 487 QVVVANGHKFTQFEQTRPVPLTPVKGQVSHIPTTENLSQLktvLCFDGYLTPqnPNNGHHCIGANYDKTNIDQEFDIEVQ 566
gi 71908463  436 VLVMASGAAAPRFEQFAWLPQRSGRGQVSHLPASVG-KPLntvLFQIGYTIP--AIDDTQLIGASLSYEDDESAEREADH 512
gi 186477810 450 VVIFANAHEAARVAGLHYASTRSVRGQLTLLPADATNAPRlp-vIGEGYALP--LLDGVTLTGATYDIDDPDTRLRDGAH 526
gi 187925901 450 VVIVASAHDAARIAGLQHAPTRSIRGQLTLLPPGAVLPPLqmpVIGEGYAVP--LADGVTLTGATYELDDPDTSLRADGH 527
gi 217970369 442 VAILAPGTGIADFEQAS-LPVVSARGQVSHLPAVAGSAPRvv-vCRGGYVSP--AVDGLRCAGATFAVDDPDPGLRPQDH 517
gi 226939885 437 VAIIANATDALHLAQTASLPLSNSRRVVTLLPETTPLAARdivICRNAYLTP--ALNGLRVLGATE--APAGAEADPHWH 512
gi 295678171 450 VVIVAGAHEAARIAGLRHAPTRSIRGQLSLLPAGTV-APLalpVIGEGYAVP--LVNGVTLTGATYELDDPDTSLRADGH 526
gi 56479346  440 VAVLANGVGIRAVPQAAALPVRSARGQVTHFPAAAGSPPNvv-vCRLGYVAP--ALDGVRSAGATFSVDDDEPALRDADQ 516
gi 91785773  450 VVIVASAHDAARIAGLQYAPTRSIRGQLTLLPAGTVRPPLelpVIGEGYAVP--LANGATLTGATYELDDPDTSLRTDGH 527
gi 119897773 438 VAILAAGTGITGFPLAAPLPVVSARGQVSLLPA-PAGSAPrvvMCRMGYVSP--AVDGLRCAGATFDVGDDDATLRARDH 514
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 218708896 567 QHNGERLHGSLPdqa--wtKDVDTSDNL---ARQGIRSVSRDHLPFVGNVGDFESIKEQYQDLhnfnpqrHSVddiqtVA 641
gi 71908463  513 RDNLARLRLTLPdf----aSDLDPATLH---GRVGFRPMSPDRMPIVGAVPDTMTATPNtrl--------------hnIP 571
gi 186477810 527 IENIERVAQMLPdmr--daFNVHAPSSLt--GRVAFRCVTSDRLPMIGAFADEAAAIRDAGKL-------CGAwp-ldLP 594
gi 187925901 528 LENLERVAQMLPaf----aNVADPARSTaltGRVAFRCVTSDRMPMIGQLADEAQAALDAQRL-------RGAwp-ldLP 595
gi 217970369 518 AENLQRLEAMIPgfgaglgAGFDPDRLD---GRVGFRPASPDRLPMVGALPLPDRPPASAArgl------------deLP 582
gi 226939885 513 AANLDKLGRMLPgq----qTGFLPDTLT---GRGCDRPSSPDRLPLVGPLPAAGARFDVKPAR---------------IE 570
gi 295678171 527 RENLERVAQMLPsf----aDALDDASLTslcGRVAFRCVTSDRMPMIGQLADEAAAARDAVRL-------RGAwp-ldLP 594
gi 56479346  517 RENLAKLEFILPgy----aAAVDTAALA---GRVGFRPASPDRLPMVGEVPAVLRADRAtpl--------------aqIP 575
gi 91785773  528 LENLARVAQMLPafa-givDRADPAALA---GRVAFRCVTSDRMPMIGQLADETVAARDAQRL-------RGAwp-ldLP 595
gi 119897773 515 HENLSKLEAMLPgy----tAALATQPAE---GRVGFRPASPDRLPMVGAVPALTTLAAPcal--------------aeIP 573
                        650       660       670       680       690       700
                 ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 218708896 642 SFPNLYCFIGLGSRGLSSAPLLAEVLASQICGDPLPLPVDVLEAIHPSRM---WVRRLRKGK 700
gi 71908463  572 RQPGLWCVQGFGARGIVWSALMADLLVSQLEGEPLPLERDLVDALDPGRF-------LIKAA 626
gi 186477810 595 RADGLYGAFAFGSRGLVWASLGAELMASQIEGEPWPIERDLAEALDPARF---LLRALRQGT 653
gi 187925901 596 RTDGLYGAFAYGSRGLVWAALGAELIASQLEGEPWPLERDLAEDIDPARF---LLRALRQGA 654
gi 217970369 583 RRPGLYALSGYGARGLVWSVLAAELLASALEGDPAPLERDLVEAIDPARF---VLRPLARTA 641
gi 226939885 571 RAPGLYCALGFGARGLAWGALAGELLASQICGEPLPVERDLAEACDPARFgwrAARQLAREK 632
gi 295678171 595 RVDGLYGAFAYGSRGLVWAALGAELIASQIEGEPWPLERDLAEDIDPARF---LLRSLRQGT 653
gi 56479346  576 RHPGLYAVAGFGARGLVWASLAAELLASHIAGEPLPLERELVDALDPARY---LLRPARGMT 634
gi 91785773  596 RTDGLYGAFAYGSRGLVWAALGAELIASQLEGEPWPLERDLAEDIDPARF---LLRALRQGT 654
gi 119897773 574 RHTGLYALSGFGARGLVWATLAAETLASQLDGEPLPLERDLVDALDPARF---LLRPARTLR 632
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap