Conserved Protein Domain Family
PRK01726

?
PRK01726: PRK01726 (this model, PSSM-Id:100924 is obsolete)
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase; Provisional
Statistics
?
PSSM-Id: 100924
View PSSM: PRK01726
Aligned: 8 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 22-Jul-2008
Updated: 31-Jul-2008
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
148828407   5 MKSRQFSTALCQNTTQS--NGQPLRFPSPAKLNLFLYINGKLPNGYHELQTLFQFLDFGDWLDISIREqDNQIVLTPEIP 82 
152979409   2 KKNYRFSTALSQFSADSfrQGKSLRFPSPAKLNLFLYINGKRADGYHELQTLFQFLDYGDWLEISARA-DGEIHLTPQLP 80 
16273498    1 MKSHQFSTALCQNTTES--NGQPLRFPSPAKLNLFLYINGKFPNGYHELQTLFQFLDFGDWLDISIREqDNQIVLTPEIP 78 
68249802    5 MKSHQFSTALCQNTTQS--NGQPLRFPSPAKLNLFLYINGKLPNGYHELQTLFQFLDFGDWLDISIREqDNQIVLTPEIP 82 
148826133   5 MKSHQFSTALCQNTTQS--NGQPLRFPSPAKLNLFLYINGKLPNGYHELQTLFQFLDFGDWLDISIREqDNQIVLTPEIP 82 
113461140   1 MKNYQFSTALLSSQIQ----GKKLRFPCPAKINLFLYITSQRPDGYHELQTLFQFLNFGDWLSIEIRT-DGKIILTSEIP 75 
52425590    1 MKTHQFSTALFSDYK----QGDSFNFPCPAKLNLFLYINGRRTDGYHELQTLFQFLDYGDWLSIKVRN-DGKIRLTPEIP 75 
15602110    1 MQHYHFSHSLLAQ------QEKPYRFPCPAKLNLFLYINGKRQDGYHELQTLFQFVDFGDWLDIEVRE-DNEICLTPELP 73 
148828407  83 NLKTENNLIYRAAKLLQEKANIQLGANIHLDKILPMGGGVGGGSSNAATALVALNYLWQANLSIDELAKLGLTLGADVPI 162
152979409  81 GVKEEDNLIYRAAHILQQNTGCTLGADIRLDKILPMGGGVGGGSSNAATVLVALNYLWKTRLSLSELADLGVKLGADVPI 160
16273498   79 NLKTENNLIYRAAKLLQEKANIQLGANIHLDKILPMGGGVGGGSSNAATALVSLNYLWQANLSIDELAKLGLTLGADVPI 158
68249802   83 NLKTENNLIYRAAKLLQEKANIQLGANIHLDKILPMGGGVGGGSSNAATALVSLNYLWQANLSIDELAKLGLTLGADVPI 162
148826133  83 NLKTENNLIYRAAKLLQEKANIQLGANIHLDKILPMGGGVGGGSSNAATALVSLNYLWQANLSIDELAKLGLTLGADVPI 162
113461140  76 HLKNEDNLIYRAAKLLQQKTGCTLGANLHLDKILPIGGGVGGGSSNAATALVALNYLWNTQLSLSTLAEIGLQLGADVPV 155
52425590   76 DLKTEDNLIYRAAKLLQQKTACRLGADLHLDKVLPMGGGVGGGSSNAATALVALNYLWKTGLSVNELAELGLKLGADVPI 155
15602110   74 SLKNEDNLVYRAAKLLQQKTNCALGANLTLDKILPMGSGLGGGSSNAATALVALNYLWNTQLSTKQLAKLGLMLGADVPI 153
148828407 163 FVHGHAAFAEGVGEKITYCEPAEKWFVILKPDDSISTAVIFQDPNLPRNTPKKSLEQLLSEPYKNDCEKVVINHYSNVEK 242
152979409 161 FIHGNAAFAEGVGEKLTDCEPPEKWFVVLKPETSISTALVFTHPDLPRNTPKRPLTRLLTEEYGNDCEKVVRNCYPEVEE 240
16273498  159 FVHGHAAFAEGVGEKITYCEPAEKWFVILKPDDSISTAVIFQDPNLPRNTPKKSLAQLLSEPYKNDCEKVVINHYSNVEK 238
68249802  163 FVYGQAAFAEGVGEKITYCEPAEKWFVILKPDDSISTAVIFQDPNLPRNTPKKSLEQLLSEPYKNDCEKVVINHYSNVEK 242
148826133 163 FVYGQAAFAEGVGEKITYCEPAEKWFVILKPDDSISTAVIFQDPNLPRNTPKKSLEQLLSEPYKNDCEKVVINHYSNVEK 242
113461140 156 FVYGKAAFAEGVGEKLTFCQPPQKWFLVLKPETSISTAIIFKDPNLPRNTPKRPLAELLITKYENDCEKVVLNHYSEVEE 235
52425590  156 FVHGKAAFAEGVGEKITYCEPPEKWYAVIKPNVSISTAKVFSEPDLTRDTKKKPLEQLLQQEYTNDCEKVVRKLYPEVEE 235
15602110  154 FVHGHAAFAEGVGEKITYCEPKEKWYVVLKPNVSISTATVFSDPDLIRNTPKQSLEQLLNQKYANDCEKVVLNHYPEVEE 233
148828407 243 ALNWLLQYAPARLTGTGACVFAEFDHEAEAQAVFRQKPEAFFGFIAKGLNVSPLHAMLKQLS 304
152979409 241 TLTWLLKYAPSRLTGTGACVFAEFDNEKSAQAVFDMKPASVSGFVAKGCNRSPLHQWLDKIS 302
16273498  239 ALNWLLQYAPARLTGTGACVFAEFDHEAEAQAVFRQKPEAFFGFVAKGLNVSPLHAMLKQLS 300
68249802  243 ALNWLLQYAPARLTGTGACVFAEFDHEAEAQAVFRQKPEAFFGFVAKGLNVSPLHAMLKQLS 304
148826133 243 ALNWLLQYAPARLTGTGACVFAEFDHEAEAQAVFRQKPEAFFGFVAKGLNVSPLHAMLKQLS 304
113461140 236 ALGWLLQYAPARLTGTGACVFAEFANEQAAQSAFLDKPEKYVGFVAQGTNISPLHQMIEYLS 297
52425590  236 LLRWLVKYAPSRLTGSGACVFAEFADEQSAQTVFNLKSKQFSGFVAQGLNVSPLHKMLEQLN 297
15602110  234 ILHRLLQYAPSRLTGTGACVFAEFNDEESAQLAFQTIPKNYFGFVAQGLNKSPLHNMLAKIS 295
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap