Conserved Protein Domain Family
PRK01381

?
PRK01381: PRK01381 
Trp operon repressor; Provisional
Statistics
?
PSSM-Id: 179289
View PSSM: PRK01381
Aligned: 129 rows
Threshold Bit Score: 127.334
Threshold Setting Gi: 156935486
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157147593   1 MAEQRHQEWLRFVELLKHACAEDLHLPLLNLMLTPDEREALGTRVRIIEELLRGEMSQRELKNELGAGIATITRGSNSLK 80
gi 161830906  20 KVPLKSEGWRGFLTLCQKAETVDQLDELFGLLFTLEEKEQLALRVELVRALLRGEKPQREIAHDLNISIAKITRGSNALK 99
gi 212218881  20 KVSLKSEGWRGFLTLCQKAETVDQLDELFGLLFTLEEKEQLALRVELVRALLRGEKPQREIAHDLNISIAKITRGSNALK 99
gi 15604888    1 MKNQEESGWQAFLTLCSKMQKEKFLQDLFSLFLSFSERKDVASRYHIIRALLEGELTQREIAEKYGVSIAQITRGSNALK 80
gi 76788888    1 MKNQEESGWQAFLTLCSKMQKEKFLQDLFSLFLSFSERKDVASRYHIIRALLEGELTQREIAEKYGVSIAQITRGSNALK 80
gi 166154380   1 MKNQEESGWQAFLTLCSKMQKEKFLQDLFSLFLSFGERKDVASRYHIIRALLEGELTQREIAEKYGVSIAQITRGSNALK 80
gi 166155255   1 MKNQEESGWQAFLTLCSKMQKEKFLQDLFSLFLSFGERKDVASRYHIIRALLEGELTQREIAEKYGVSIAQITRGSNALK 80
gi 237802594   1 MKNQEESGWQAFLTLCSKMQKEKFLQDLFSLFLSFSERKDVASRYHIIRALLEGELTQREIAEKYGVSIAQITRGSNALK 80
gi 237804516   1 MKNQEESGWQAFLTLCSKMQKEKFLQDLFSLFLSFSERKDVASRYHIIRALLEGELTQREIAEKYGVSIAQITRGSNALK 80
gi 89898247    2 AQASNENGWSDFLELCSKIKTPEAFRDFFALFLTFGERESMASRYLIIQALLADQLTQREIAKEYGVSIAQITRGSNALK 81
                         90
                 ....*....|....*....
gi 157147593  81 SAPVELRQWLEQVLLKSER 99
gi 161830906 100 TTSHKIKSFIKKYLP---- 114
gi 212218881 100 TTSDKIKSFIKKYLP---- 114
gi 15604888   81 GLDPQFKEFLQKEI----- 94
gi 76788888   81 GLDPQFKEFLQKEI----- 94
gi 166154380  81 GSDPQFKEFLQKEI----- 94
gi 166155255  81 GSDPQFKEFLQKEI----- 94
gi 237802594  81 GLDPQFKEFLQKEI----- 94
gi 237804516  81 GLDPQFKEFLQKEI----- 94
gi 89898247   82 AVDPEFKEFLKHSSGRYEN 100
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap