Conserved Protein Domain Family
murD

?
PRK01368: murD 
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional
Statistics
?
PSSM-Id: 179286
View PSSM: PRK01368
Aligned: 15 rows
Threshold Bit Score: 682.337
Threshold Setting Gi: 148284827
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
229586685   1 MNSHTKQKIGVFGLGKTGISVYEELQNKYDVIVYDDLKANRDIFEELYSKTAIAALSDSRWQNLDTIVLSPGIPLTHEIV 80 
51473598    1 MNAYTKQKIGIFGLGKTGISVYEELKNKYDLIVYDDLKAKRDIFEKLFGNKLITILSDSRWQDLDKIVLSPGVPLTHEVV 80 
157825688   1 MHSNTKQKIGVFGLGKTGMSVYEELHGKCDIIIYDDLKANRDIFEKLYSKSAIVALSDLRWQNLDKIILSPGVPLTHKIV 80 
157803837   1 MHSHTKQKIGIFGLGKTGISVYEELQNKYDVIVYDDLKANRDIFEELFGKNLIAALSDSRWQNLDKIVLSPGVPLTHEIV 80 
91205696    1 MTIHKKQNIGVFGFGKTGISVYEELQSKCNIIAYDDLEVNRNKFEELFSKNYIIPISDIKWQNLDKIVLSPGIPLTHEIV 80 
157826844   1 MTIHKKQNIGVFGLGKTGISVYEELQSKCNIIAYDDLEVNRNKFEELFSKNYIIPISDIKWQNLDKIVLSPGIPLTHEIV 80 
67459026    1 MNSHTKQKIGVFGLGKTGISVYEELQGKCDVIVYDDLKANRDIFEELYTNNSIAALSDSRWQNLDKIVLSPGIPLTHKIA 80 
238650901   1 MNSHTKQKIGVFGLGKTGISVYEELQNKYDVIVYDDLKANRDIFEELYSKTAIAALSDSRWQNLDTIVLSPGIPLTHEIV 80 
15604275    1 MNAYKKQKIGIFGLGKTGISVYEELKNKYDLIVYDDLEANRDIFKELFGNNLITVLSDSRWQDLDKIVLSPGVPLTHEVV 80 
165933147   1 MNSHTKQKIGVFGLGKTGISVYEELQNKYDVIVYDDLKANRDIFEELYSKTAIAALSDSRWQNLDTIVLSPGIPLTHEIV 80 
229586685  81 NIAKSFSIPITSDIDLLFAKSKNLKFIAITGTNGKSTTTALISHILNSSGLDYPVAGNIGVSALQAKASKDGYVLELSSF 160
51473598   81 RIAHHFNIPIISDIDLLFEKSKNLKFIAITGTNGKSTTAALISHILNSNGLDYTVAGNIGVPALQAKASKDGYVLELSSF 160
157825688  81 GIAKNFNIPVISDIDLLFEKSKNLNFIAITGTNGKSTTTALISHILNSSGLDYQVAGNIGVPALQAKASKDGYVLELSSF 160
157803837  81 RIAHHFNISITSDIDLLFEKSRNLNFIAVIGTNGKSTTTALISHILNSNGLDYPVAGNIGVPALKAKNSKDGYVIELSSF 160
91205696   81 KIAKNFNIPITSDIDLFFEKSKGLNLLAVTGTNGKSTTTALISHILSDNGLDYPVAGNIGVPVLQAKASKGGYVLELSSF 160
157826844  81 KIAKNFNIPITSDIDLFFEKSKGLNLLAVTGTNGKSTTTALISHILSDNGLDYPIAGNIGVPVLQAKASKGGYVLELSSF 160
67459026   81 GIAKNFNIPIISDIDLLFEKSKNLNFIAVTGTNGKSTTTALISHILNSNGLDYPVAGNIGVPALQAKASKDGYILELSSF 160
238650901  81 NIAKSFNIPITSDIDLLFAKSKNLKFIAITGTNGKSTTTALISHILNSSGLDYPVAGNIGVSALQAKASKDGYVLELSSF 160
15604275   81 RIAHHFNIPIISDIDLFFEKSKNLKFIAITGTNGKSTTTALISHILNSNGLDYPVAGNIGVPALQAKASNEGYVLELSSF 160
165933147  81 NIAKSFNIPITSDIDLLFAKSKNLKFIAITGTNGKSTTTALISHILNSSGLDYPVAGNIGVSALQAKASKDGYVLELSSF 160
229586685 161 QLDLVKTFTAKIAVLLNITPDHLDRHQDMTCYIAAKSKIFDRMDQESYAVINIDNDYCREVFIKLQQEQRIKLIPFSVAQ 240
51473598  161 QLDLVKIFTVKVAVLLNITPDHLDRYQDMNGYIAAKAKIFDRMDKDSYAVINIDNDYCRKIFLLLQREQLIKLIPFSVTK 240
157825688 161 QLDLVKIFTAKIAVLLNITPDHLDRHQHMNGYIAAKSKIFDRMDKDSYAVINIDNDYCREIFITLQQEQRIKLVPFSVTK 240
157803837 161 QLDLVKTFTAKIAVLLNITPDHLDRHKDMNGYIKAKSKIFNRMDKNSYAVINIDNDYCRKIFMKLQQEQRIKLIPFSVTK 240
91205696  161 QLDLVKTFAAKIAVLLNITPDHLDRHENMEGYITAKSKIFDRMDKDSYGIINIDNDYCHEIFTNLQQKHHIKLIPFSVTK 240
157826844 161 QLDLVKTFAAKIAVLLNITPDHLDRHENMEGYITAKSKIFDRMDKDSYGIINIDNDYCHEIFTNLQQKHHIKLIPFSVTK 240
67459026  161 QLDLVKTFTAKIAVLLNITPDHLDRHQDMTGYIAAKSKIFDRMDKDSYAAINIDNYYCREIFMLLQQEQRIKLIPFSVTK 240
238650901 161 QLDLVKTFTAKIAVLLNITPDHLDRHQDMPCYIAAKSKIFDRMDQESYAVINIDNDYCREVFIKLQQEQRIKLIPFSVTQ 240
15604275  161 QLDLVKSFTVKVAVLLNITPDHLDRYQDMNDYIAAKAKIFDRMDKDSYAVINIDNDYCRKIFVLLQKDQSIKLIPFSVTK 240
165933147 161 QLDLVKTFTAKIAVLLNITPDHLDRHQDMPCYIAAKSKIFDRMDQESYAVINIDNDYCREVFIKLQQEQRIKLIPFSVTQ 240
229586685 241 ILENGISVVDDKISANffdDISFELqhnseslrqyefqgepvepecikirehrqdlqnslvssfmhyavPFNKNLQGVHN 320
51473598  241 ILNNGISIVDDKIHDN---NLTYKL--------------------------------------------PLNKNLQGLHN 273
157825688 241 ILENCISVVDNKINDNffdDIRFECqynsesfrqnefqgepaerik--vcehrldlqnslvsnflndavPFNNNLQGTHN 318
157803837 241 ILEKGISVVNNIINYSffgNSNFKL--------------------------------------------PFNKNLQGIHN 276
91205696  241 ILEKGISIVNDIITDNffeHISFKL--------------------------------------------ISNKSLQGIHN 276
157826844 241 ILEKGISIVNDIITDNffeHISFKL--------------------------------------------ISNKSLQGIHN 276
67459026  241 ILKNGISVVGDKINDN---DISYKL--------------------------------------------PFNKNLQGTHN 273
238650901 241 ILENGISVVDDKISANffdDISFELqhnsesfrqdefqgepaepecikirehrqdlqnslvssfmhyavPFNKNLQGIHN 320
15604275  241 ILKNGISIVDDKIHDN---DLTYKL--------------------------------------------PLNKNLQGLHN 273
165933147 241 ILENGISVVDDKISANffdDISFELqhnsesfrqdefqgepaepecikirehrqnlhnslvssfmhytvPFNKNLQGVHN 320
229586685 321 CENIAASYAVAKIIGV-EPKKILESISSFQSLPHRMQYIGSINNISFYNDSKATNAISAVQSIKALDNIYWLAGGIPKEG 399
51473598  274 CENIAASYAVSKIIGV-ESKKILESISSFQSLHHRMQYIGSINNISFYNDSKATNAISALQSIKALDNIYWLAGGIPKEG 352
157825688 319 DENIAASYAVAKIIGV-EPKKILESISGFQSLPHRMQYICSINNINFYNDSKATNAISAVQSIKALDNIYWLAGGIPKDG 397
157803837 277 CENIAASYAVAKIMGLeESTKIIEAISSFQSLPHRMQYIGSINNISFYNDSKATNAISALQSIKALDNIYWLAGGIPKEG 356
91205696  277 SENIAASYAVARIIGL-EPVKIIESISSFQGLPHRMQYLGNIDDINFYNDSKASNAIAAVQSIKALDNIYWLAGGIAKEG 355
157826844 277 SENIAASYAVARIIGL-EPVKIIESISSFQGLPHRMQYLGNIDDINFYNDSKATNAIAAVQSIKALDNIYWLAGGIAKEG 355
67459026  274 CENIAASYAVAKIIGV-ESKKILESISSFQSLPHRMQYIGSINNIGFYNDSKATNAISAVQSIKALDNIYWLAGGIPKEG 352
238650901 321 CENIAASYAVAKIIGV-EPKKILESISSFQSLPHRMQYIGSINNISFYNDSKATNAISAVQSIKALDNIYWLAGGIPKEG 399
15604275  274 CENIAASYAVAKIIGL-ESKKILESISSFQSLHHRMQYIGSINNISFYNDSKATNAISALQSIKALDNIYWLAGGIPKEG 352
165933147 321 CENIAASYAVAKIIGV-EPKKILESISSFQSLPHRMQYIGSINNISFYNDSKATNAISAVQSIKALDNIYWLAGGIPKEG 399
229586685 400 GIEEIKPYFSHIKKAYFYGQAKEIFANTAKNIVDFIICDNLEQAFDLAYKDAVGDNAEVKNILLAPSCSSYDQFKNFEER 479
51473598  353 GIEGIKPYFNKIKKAYFYGQAKTMFANTAKNIIDCVICDNLEYAFNIAYKDAVSDNTEIKNILLAPSCSSYDQFKNFEER 432
157825688 398 GIECIKPYFSKIKKAYFYGQAKEIFANTTKNIVDFVICDNLEQAFDLAYKDAVGDNAELKNILLAPSCSSYDQFKNFAER 477
157803837 357 GIKEIMPYLNRIKKAYFYGQAKEMFADTVKNIVDFVICNDLKQVFDLAYKDAVGDTAAVKNILLAPSCSSYDQFKNFEER 436
91205696  356 GIEEIKPYFSKIKKAYFYGQAKEMFANTAKDIIDFVICDDLKQAFELAYKDACKDNEKEKNILLAPCCSSYDQFKNFEER 435
157826844 356 GIEEIKPYFSKIKKAYFYGQAKEMFANTAKDIIDFVICDDLKQAFELAYKDACKDNEKEKNILLAPCCSSYDQFKNFEER 435
67459026  353 GIEEIKPYFSKIKKAYFYGQAKEIFAKTAKNIVDFVICDNLEQAFDLAYKDAVGDNAEVKNILLAPSCSSYDQFKNFEER 432
238650901 400 GIEEIKPYFSQIKKAYFYGQAKEIFANTAKNIVDFVICDNLEQAFDLAYKDAVGDNSEVKNILLAPSCSSYDQFKNFEER 479
15604275  353 GIEGIKPYFNKIKKAYFYGQAKAMFANTAKNIIDFVICDNLEYAFNIAYKDAVSDTTEVKNILLAPSCSSYDQFKNFEER 432
165933147 400 GIEEIKPYFSQIKKAYFYGQAKEIFANTAKHIVDFVICDNLEQAFDLAYKDAVGDNAEVKNILLAPSCSSYDQFKNFEER 479
229586685 480 GELFIKL----CSILSLRG 494
51473598  433 GELFIKLsknvIGSNYLLS 451
157825688 478 GELFIKL----CSILSPVA 492
157803837 437 GELFIKLylekAKHKKNTI 455
91205696  436 GELFIRL----YNTLNLCL 450
157826844 436 GELFIRL----YNTLNLCL 450
67459026  433 GELFMKLskrhCEEITK-- 449
238650901 480 GELFIKL----CSILSLRG 494
15604275  433 GELFIKLskrhWQ------ 445
165933147 480 GELFIKL----CSILSLRG 494
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap