Conserved Protein Domain Family
xerC

?
PRK01287: xerC 
site-specific tyrosine recombinase XerC; Reviewed
Statistics
?
PSSM-Id: 234935
View PSSM: PRK01287
Aligned: 37 rows
Threshold Bit Score: 532.785
Threshold Setting Gi: 17548311
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
259909812   1 MTRPNPPTATEIHISRHGQTLRQLAESWLAHLVVAGRSPRTVQGYRERVRAFLAWCEPRGITYAPQVSLAVLEAYQRWLQ 80 
300723777   1 --------------METPPTLRQQLEAYLDTVVDRGYSKRTQEAYRERLRPFVDWCELRDVRHAPQVSLALLESWQRYLR 66 
253990479   1 ---------metqpTFTLATLRQQLEAYLEIQTASGHSTRTPETYREWLTPFVDWCEMRAVYHAPQVSLPLLESWQRYLR 71 
253988443   1 ---------metqpTFTLATLRQQLEAYLEIQTASGHSTRTPETYREWLTPFVDWCEMRAVYHAPQVSLPLLESWQRYLR 71 
253988421   1 ---------metqpTFTLATLRQQLEAYLEIQTASGHSTRTPETYREWLTPFVDWCEMRAVYHAPQVSLPLLESWQRYLR 71 
50122313    1 MTKPKPPSPEALYLSSLSQTLRQYTTAYLAHLTATNHSPRTVEGYGERLRPFVTWCEERGLTQAAQVSLAVLEAYQRHLH 80 
50122323    1 MTKPKAPTPEATYLSSLSQTLRQYTTAYLAHLTATNHSPRTVEGYGERLRPFVTWCEERGLMQAAQVSLAALEAYQRHLH 80 
50122339    1 MTKPKAPTPQALYLSCLSQTLRQYTTAYLEHLTATNHSPRTVEAYSERLRPFVTWCEERGLTQAAQVSLSVLEAYQRHLH 80 
50122330    1 MTKPKAPTPQALYLSCLSQTLRQYTTAYLEHLTATNHSPRTVEAYSERLRPFVTWCEERGLTQAAQVSLSVLEAYQRHLH 80 
50123203    1 MTRPTPPSPEALYLSRQTQTLRQHTEHYLEHLSAAGYSARTQESYWERLLPFVAWCEDRGLLHAPQVSLAVLEGYQRWLR 80 
259909812  81 GYRRADGKQLVVNSQLGVLTAIRMLFRWLLQRHVILYNPAELLALPKEERRLPAQVFSEAETRRVLQSLDAGTPPGLRNR 160
300723777  67 SYRKADGQYYTSGGLINRLSALRGWFRWLLKRHHILYNPAELLTMPKEEKRLPAQVLSETETETVLMSIDIQTPLGLRNR 146
253990479  72 RYRKADGQHYGNNSQLQRLRCLRGWFRWLLQRHHILYNPADMLILPKEEQRLPAQVLSDVETEQVLNSLDTQTPLGLRNR 151
253988443  72 RYRKADGQHYGNNSQLQRLRCLRGWFRWLLQRHHILYNPADMLILPKEEQRLPAQVLSDVETEQVLNSLDTQTPLGLRNR 151
253988421  72 RYRKADGQHYGNNSQLQRLRCLRGWFRWLLQRHHILYNPADMLILPKEEQRLPAQVLSDVETEQVLNSLDTQTPLGLRNR 151
50122313   81 GYRKADGKPLAQGGQLNRLTSIRMLFRWLLQRHHILYNPAEQMTLPKAEKRLPAQILSEEETEAVMDAQDTETLTGLRNR 160
50122323   81 GYRKADGKPLAQGGQLNRLTSIRMLFRWLLHRHHILYNPAEQLTLPKAEKRLPAQILSEEETEAVMDAQDTDTLTGLRNR 160
50122339   81 GYRKADGKPLAQGGQLNRLSAIRGLFRWLLQRHHILYNPAEQITLPKAEKRLPAQILSEEETEAVMEAQDTDTLTGLRNR 160
50122330   81 GYRKADGKPLAQGGQLNRLSAIRGLFRWLLQRHHILYNPAEQITLPKAEKRLPAQILSEEETEAVMEAQDTDTLTGLRNR 160
50123203   81 GYRKADGHPLTAGSQLNRLTGIRMLWRWLLKRHVILYNPAEMLTLPKEEKRLPAQVLSVEETGGVLQAMESGTVLGLRNR 160
259909812 161 AILELLWSSGIRRSELAGLLLSDVDFTRGVVNVRRGKGGKDRVVPVGHTALMWLGRYLKDVRPRLAQRFDSGHLFISHKG 240
300723777 147 ALLEVFWSTGIRRNELINLKLSDIDSGRGVIMVRQGKGRKDRVVPIGERALAWVNRYLADVRPRLAWKYDSGYLFITLKG 226
253990479 152 AVLEALWSTGIRRTELINLRLGDIDRHRGVVVVRQGKNGHDRVVPIGERALAWLERYLADVRPQLAYRYDSGYVFITVRG 231
253988443 152 AVLEALWSTGIRRTELINLRLGDIDRHRGVVVVRQGKNGHDRVVPIGERALAWLERYLADVRPQLAYRYDSGYVFITVRG 231
253988421 152 AVLEALWSTGIRRTELINLRLGDIDRHRGVVVVRQGKNGHDRVVPIGERALAWLERYLADVRPQLAYRYDSGYVFITVRG 231
50122313  161 AVLEMLWSTGLRRSELAGLMLDDVDVGRGVLVVRQGKGNKDRVVPVGLRALVWVQRYLDAVRPRLTTKHDSGALFVTIWG 240
50122323  161 AVLEMLWSTGLRRSELAGLMLDDVDVGRGVLVVRQGKGNKDRVVPVGLRALVWVQRYLDAVRPRLTTRHDSGYLFVTIWG 240
50122339  161 AVLEMLWSTGLRRSELSGLMLADVDVGRGVLVVRQGKGNKDRVVPVGLRALVWVQRYLDAVRPRLTTKHDSGYLFVTIWG 240
50122330  161 AVLEMLWSTGLRRSELSGLMLADVDVGRGVLVVRQGKGNKDRVVPVGLRALVWVQRYLDAVRPRLTTKHDSGYLFVTIWG 240
50123203  161 VILEVLWSSGVRRAEAVSLMLSDIDLSRGVMMVRQGKGNKDRVVPLGERACKWLARYLNHARPALARRYDSGHLFISHNG 240
259909812 241 TGLAHGTLTAMAGRAIREGAhLKKaGACHIFRHSMATQMLENGADTRHIQAILGHEKLETTQIYTRVAIGHLQKVHAHTH 320
300723777 227 QPLARSTVTLMAGRTIRQQArLNKpGTCHVFRHSMATQMLENGADTRHIQAILGHEKLETTQIYTRVAIGHLKAVHHQTH 306
253990479 232 NPLSRNTLTQMAGHTIREEAkLDKaGSCHVFRHSMATQMLENGADTRHIQAILGHKKLETTQIYTRVAIGHLKEVHEQTH 311
253988443 232 NPLSRNTLTQMAGHTIREEAkLDKaGSCHVFRHSMATQMLENGADTRHIQAILGHKKLETTQIYTRVAIGHLKEVHEQTH 311
253988421 232 NPLSRNTLTQMAGHTIREEAkLDKaGSCHVFRHSMATQMLENGADTRHIQAILGHKKLETTQIYTRVAIGHLKEVHEQTH 311
50122313  241 KTLGRATLTILAGSAIREQAhLKKaGACHVFRHSMATQMLENGADTRYIQAILGHEKLETTQIYTRVAIGHLKQVHEKTH 320
50122323  241 KRLGRATLTILAGRAIRNDAhLKKaGACHVFRHSMATQMLENGADTRHIQAILGHEKLETTQIYTRVAIGHLKQVHEKTH 320
50122339  241 KRLARSTLTILAGRAIRDDAhLKKaGACHVFRHSMATQMLERGADTRHIQAILGHEKLETTQIYTRVAIGHLKQVHEKTH 320
50122330  241 KRLARSTLTILAGRAIRDDAhLKKaGACHVFRHSMATQMLERGADTRHIQAILGHEKLETTQIYTRVAIGHLKQVHEKTH 320
50123203  241 TGLARVTLTKMAGKAIRETGhLDKpGACHVFRHSMATQMLENGADTRHIQAILGHEKLETTQIYTRVAISHLQKVHEQTH 320
259909812 321 PAEKRRTEKLAEQPE 335
300723777 307 PAER----DSRADSD 317
253990479 312 PAERKPKKQKTPpdn 326
253988443 312 PAERKPKKQKTPpdn 326
253988421 312 PAERKPKKQKTPpdn 326
50122313  321 PAERKPTARRRKRKP 335
50122323  321 PAERKLKPRRRKKRK 335
50122339  321 PAERKPRRRKKRKPD 335
50122330  321 PAERKPRRRKKRKPD 335
50123203  321 PAERKQTARRKKKRD 335
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap