Conserved Protein Domain Family
PRK01123

?
PRK01123: PRK01123 
shikimate kinase; Provisional
Statistics
?
PSSM-Id: 234906
View PSSM: PRK01123
Aligned: 50 rows
Threshold Bit Score: 298.337
Threshold Setting Gi: 13542149
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
289583042   1 MDGRAVAPAAGTVLNALATGTGSAFAIDLETTATVELEQHEklaeheidtvdghI--VGHPDADTDLIERCVELTIAAFA 78 
171185276   2 GCAVGCAYGGGTVINAIATGHGAAFPISLRVAARVCASDR--------------FevSTYADVDISPVRRIVERIAERFG 67 
18312998    2 ECASGCAYGGGTIINAIATGHGAAFPISLRVAAEVCLSDS--------------PsvSTYADVDVGPIYKILTRLGEKLG 67 
145592238   2 DCARACAWGGGTIINAIATGHGAAFPISLRVMAEVCRSDR--------------LevATYADVDVEPIRKVVQMVAERWG 67 
119873277   2 VCATGCAYGGGTIINAIATGHGAAFPISLKISARVCTSDK--------------FevSTYADVDISPVKRIVEKVAERFG 67 
126459528   2 KCARACAWGGGTIINAIATGLGAAFPISMRATAEVCEAERDs--------------vSTYADVDMGPVLRAVALVREKLG 67 
16081425    2 KYARVRTHGGVSIISAFIDGMGGAFSIDVPMTVTVR-------------------------EGTCSEEKKISEDIRRYLS 56 
13542149    2 KFAEATTNGGISILSAFIDGLGGAFSIDLPLTATVYAGTRRr-------------------------EDRLMEAIRSEFG 56 
296108830   1 MEGEAYALASGTIINAIATGKGGAFGLDLKVYAKVRLIDDGknri------egkV---LDHKIEPNLIVRCVKNTLEYFG 71 
256810156   1 MEGKAYALASGTIINAIATGKGSAFGLDLKVYARVKLIDDGknri------egrV--LDNPNIKPNLIIRCVKNTLDYFG 72 
289583042  79 ADAgldpetvGGRVRTESEVPLAAGLKSSSAAANATVLATLDALGVadAVDRIDACRLGVRAAREAGVTATGAFDDASAS 158
171185276  68 LG--------PLSVEISGDLPTAGGLKSSSAAVNAVIIAAAKLAGA--RLDLFDVARLNAELSRWAGISVTGAFDDAVAS 137
18312998   68 VG--------PVSVRITGDLPTAGGLKSSSATVNAIIIAMFKLAGR--EADLFNIARLNAELSKEAGISVTGAFDDAVAS 137
145592238  68 VG--------PVAVKITGDLPPAGGLKSSSAVVNALVSATAKLAGA--DVDLFDVTRINAQLSREVGISVTGAFDDAVAS 137
119873277  68 LG--------PLSVEISGDLPTAGGLKSSSAVVNAIIIATTKLAGA--RLDLFDVARLNAELSRWAGISVTGAFDDAVAS 137
126459528  68 LG--------PLSVRIEGDLPTAGGLKSSSATLNAVIRAAAELAGV--KLDLFDAARLNAQISREVGISVTGAFDDAVAS 137
16081425   57 IAT-------CFRFTVDSRIPSGYGLKSSSAYILALAKAMAVYSGI--DISDMEIMTASADISKNSGLSMTGALDDLCQA 127
13542149   57 IKD-------QLTYKVKSSIPAGYGLKSSSALVLALAKASLLYKSV--DIEDADLLVRLANISKAVGLSATGALDDLCQA 127
296108830  72 YNY-------SAYVETRTEIPIKSGLSSSSAVSNATVLATISALGE--KVDDKVVLDLAIKSCFDEKLTVTGAYDDATAS 142
256810156  73 LNY-------SAYVETKTEIPIKSGLSSSSATSNAVVLATFDALNE--KIDDELILNLGIKSSFDEKLTVTGAYDDATAS 143
289583042 159 MLGGVTITDNTGDELLAREAFDddLQALVYTPPEQAFSADADIDACKRVAPMARLVEELALDGRYGEAMTVNGFAFCGVL 238
171185276 138 ATGRSYLTDNYKMLVIRDLDVS--GRAVVLIPPYE--KRRHKLDEMRALAPVVRTAVAYAGLGMWREAMLINAVAYGYAL 213
18312998  138 AVGRSYLTDNYKMIVLRELDVS--GRAVVLIPPYE--KRRQRLEEMRAIAPVIRTAVAYAGLGMWREAMLINAVAYGYAL 213
145592238 138 ATGRSYLTDNYKLVVIRELDVS--GKAVVLIPPYE--KRRHKLQEMRALAPVVRTAVSFAGMGMWREAMLINAVAYGYAL 213
119873277 138 ATGRSYLTDNYKMLVIRDLDVS--GRAVVLIPPYE--KRRYRLEEMRSLAPVIRTAVAYAGLGMWREAMLINAIAYGYAL 213
126459528 138 AVGRAYLTDNFKLVVIRELDVS--GRAVVLIPPWE--KRRHKLEEMGALAPVVRVAVSHAGLGMWKEAMLINAVAYGYAL 213
16081425  128 MYGGYCLTDNRKMKILRRGRL---PEMPVLVCADGDKRSSGKVSIEGHFTNAIRRVEDLAFKGRIFDAAVANGLIYGSIF 204
13542149  128 LYGGYCITDNKRMKIIKRGKL---PELAVLVCARGETRPSRSINIRGNYFKVARSAENLAQRGFIFQAAVLNGFIYGTIF 204
296108830 143 YYGGVCITDNIKREILKRDRLRenLKIYVILPN---LKKNVDVKRMKLLKNFVEPVFNLALNGEYFKALFLNGLLYSSAL 219
256810156 144 YYGGITITDNLGRKILKRDKMRedLNVLVLIPN---LEKNVDVNRMRLIKDYIEIAFNEAIEGNYFKALFLNGILYASAL 220
289583042 239 EFPTGPMVEALPD-VKGVSLSGTGPSYVAIGEQESLEAVRERWDDRdGTTRILQLRTDGTRVQ 300
171185276 214 GYPPEPTLEALKLgAVG-GVSGTGPSHVFISD--EPERLADALAKF-GKVYVVDIPNSPCQT- 271
18312998  214 GYPPEPTLEALKLgAVG-GVSGTGPAHVFIAE--NPEEVAAALSKY-GRVYVVDIPQSPCST- 271
145592238 214 GYPPEPTLEALQLgAVG-GVSGTGPSHVFITD--KPEELAEALSKY-GKVYVVDIPQSPCTP- 271
119873277 214 GYPPGPTLEALRLgAVG-GVSGTGPSHVFISD--EPERLAEVLAKY-GKVYVVDIPQSAPLC- 271
126459528 214 GYPPDPLLDALKLgAVG-GVSGTGPSHVFVAE--DPERLAQALAKY-GKTYVVDIPRGPCEA- 271
16081425  205 GMDLRLIGSMLKAgALYSSQSGKGPAIFGIFA--DRRSAMNARSDI-GFGIVTKINNQGIRYW 264
13542149  205 GIDLETVRKIEENgANYASQSGKGPAVFGLFT--DPSDAKRAKMDI-GFGIVTKINNHGIRYR 264
296108830 220 NFPTDIAIKCLEAgAITAGLSGTGPSYIAIAE----EDIREKLEGL-GKVIETRVNNEGARVL 277
256810156 221 NFPTNIAIDALEAgAITAGLSGTGPGYIAIAEDEDVEKVKNALEKY-GKVILTKPNNEGASIY 282
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap