Conserved Protein Domain Family
PRK00650

?
PRK00650: PRK00650 
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase; Provisional
Statistics
?
PSSM-Id: 134340
View PSSM: PRK00650
Aligned: 10 rows
Threshold Bit Score: 512.087
Threshold Setting Gi: 62185389
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
29840572    1 MDFFSPAKLNLFLKLHGKTSRGFHEMTTQYQVIDFGDTLCLERSNEDTL-ICNLPELSTPQNLVWKSLQIFRDYTQVNDP 79 
15605538    1 MHFLSPAKLNLFLQILGRREDDFHEIVTRYQAIAFGDQLSLSISSRDSLqVINACHLETPSNSIWKSVALFRRYTGITTP 80 
76789547    1 MHFLSPAKLNLFLQILGRREDDFHEIVTRYQAIAFGDQLSLSISSRDSLqVINACHLETPSNSIWKSVALFRRYTGITTP 80 
166154146   1 MHFLSPAKLNLFLQILGRREDDFHEIVTRYQAIAFGDQLSLSISSRDSLqVINACHLETPSNSIWKSVALFRRYTGITTP 80 
166155021   1 MHFLSPAKLNLFLQILGRREDDFHEIVTRYQAIAFGDQLSLSISSRDSLqVINACHLETPSNSIWKSVALFRRYTGITTP 80 
237803235   1 MHFLSPAKLNLFLQILGRREDDFHEIVTRYQAIAFGDQLSLSISSRDSLqVINACHLETPSNSIWKSVALFRRYTGITTP 80 
237805156   1 MHFLSPAKLNLFLQILGRREDDFHEIVTRYQAIAFGDQLSLSISSRDSLqVINACHLETPSNSIWKSVALFRRYTGITTP 80 
15834807    1 MHFFSPAKLNIFLQLLGKREDGFHEIVTRYQAVSFGDQLSLSVSSRDSFqIINDCQLEISNNSIWKSTALFRQYTGITDP 80 
62185389    1 MDLFSPAKLNLFLKLHGKTSHGFHEMTTLYQVIDFGDRLSLESSSEDSL-ICNLPELNTPQNLIWKSIQVFRDYTQIYSP 79 
89898006    1 MDLFSPAKLNLFLKLHGKTSHGFHEMTTQYQVIDFGDNLYLESSNEDSL-VCNLPELNTPQNLIWKSLQVFRDYTQIRSP 79 
29840572   80 VAWRLHKRIPIGAGVGGGSSNAATALYALNEHFQTQLSNDELQELGKKIGMDVPLFFSSGSAIGVGCGEEILPYEDyNCE 159
15605538   81 VSWRVVKQIPVGAGLAGGSSNAATALFALNQIFKTGLSDEEMRSLAEQLGVDTPFFFSTGAALGVARGEKIIALEE-SVS 159
76789547   81 VSWRVVKQIPVGAGLAGGSSNAATALFALNQIFKTGLSDEEMRSLAEQLGVDTPFFFSTGAALGVARGEKIIALEE-SVS 159
166154146  81 VSWRVVKQIPVGAGLAGGSSNAATALFALNQIFKTGLSDEEMRSLAEQIGMDTPFFFSTGAALGVARGEKIIALEE-SVS 159
166155021  81 VSWRVVKQIPVGAGLAGGSSNAATALFALNQIFKTGLSDEEMRSLAEQIGMDTPFFFSTGAALGVARGEKIIALEE-SVS 159
237803235  81 VSWRVVKQIPVGAGLAGGSSNAATALFALNQIFKTGLSDEEMRSLAEQLGVDTPFFFSTGAALGVARGEKIIALEE-SVS 159
237805156  81 VSWRVVKQIPVGAGLAGGSSNAATALFALNQIFKTGLSDEEMRSLAEQLGVDTPFFFSTGAALGVARGEKIIALEE-SVS 159
15834807   81 VSWRVVKHIPIGSGLAGGSSNAATALFALNQMFQTGLSDEELRSLAEKVGMDTPFFFSSGSALGLGRGEKVVTLNE-LVV 159
62185389   80 VAWRLYKCIPIGSGIGGGSSNAATALYALNQHFQTQLSNDVLQELGKKIGMDVPLFFSLGSALGIGCGEEILSYDNdHRD 159
89898006   80 VAWRLHKRIPIGAGVGGGSSNAATALYALNEHFQTQLPNSVLQELGKKIGMDVPLFFSSGSAIGVGCGEKILPYKDcKRE 159
29840572  160 ERYVLYFSDQGVLTKDAFSYVHPEDFSHRKDaiaLYERDNDLEKSVFRFRKDLEEKKQMLKRMWSPFHAHVGMSGAGATL 239
15605538  160 DRYVLYFSSEGVLTSRAFAAVQPSDCSSRKN---LEYTQNDLEKPVFRLRLDLKEKKHWLENLWAELPVHIGLTGSGATL 236
76789547  160 DRYVLYFSSEGVLTSRAFAAVQPSDCSSRKN---LEYTQNDLEKPVFRLRLDLKEKKHWLESLWAELPVYIGLTGSGATL 236
166154146 160 DRYVLYFSSEGVLTSRAFAVVQPSDCSSRKN---LEYTQNDLEKPVFRLRLDLKEKKHWLESLWAELPVHIGLTGSGATL 236
166155021 160 DRYVLYFSSEGVLTSRAFAVVQPSDCSSRKN---LEYTQNDLEKPVFRLRLDLKEKKHWLESLWAELPVHIGLTGSGATL 236
237803235 160 DRYVLYFSSEGVLTSRAFAAVQPSDCSSRKN---LEYTQNDLEKPVFRLRLDLKEKKHWLESLWAELPVYIGLTGSGATL 236
237805156 160 DRYVLYFSSEGVLTSRAFAAVQPSDCSSRKN---LEYTQNDLEKPVFRLRLDLKEKKHWLESLWAELPVYIGLTGSGATL 236
15834807  160 DRYILYFSNKGVLTSEAFAVVKPSDCSLSKD---LEYARNDLENPVFRLRLDLKEKKRWLEDLWKGIPVYVGLTGSGATL 236
62185389  160 ERYVLYFSDQPVLTKDAFSYVRPEDFSKREEclsLYARNNDLEQSVFRFRKDLEEKKHMLKRIWSPFNAHVRMSGAGATL 239
89898006  160 ERFVLYFSDQGVLTKDAFSYVRSEDFSQREEnisLYKKENDLEKSVFRFRRDLEEKKQMLKKMWSPFHAHVCMSGAGATL 239
29840572  240 FVSYPREMETDPSVAKAIHTTIQDSHGLLVNSLRKQSSGWFLNSDNLFTAAR 291
15605538  237 FVRYPEILEEDLSYAAQIQRAVTLSGGLLTSPIRRDPTAWYSIYSESALAAT 288
76789547  237 FVRYPEILEKDLSYAAQIQRAVTLSGGLLTSPIRRDPTAWYSIYSESALAAT 288
166154146 237 FVRYPEILEEDPSYAAQIQRAVTLSGGLLTSPIRRDPTAWYSIYSESALAAT 288
166155021 237 FVRYPEILEEDPSYAAQIQRAVTLSGGLLTSPIRRDPTAWYSIYSESALAAT 288
237803235 237 FVRYPEILEKDLSYAAQIQRAVTLSGGLLTSPIRRDPTAWYSIYSESALAAT 288
237805156 237 FVRYPEILEKDLSYAAQIQRAVTLSGGLLTSPIRRDPTAWYSIYSESALAAT 288
15834807  237 FVRYPKALEKNSAYATQIQKIIALSGGVSTSPIQRDTPNWYPTILEA----- 283
62185389  240 FVSYSREIETDPSTAKALHATIHNSQGLLVNSLRKY-NGWFEHGDNLLATTR 290
89898006  240 FVSYPRKLEIDPSIAKAIHATIQNSQGVLVNSLRKH-SGWFPCPDNLFATTR 290
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap