Conserved Protein Domain Family
PRK00555

?
PRK00555: PRK00555 
galactokinase; Provisional
Statistics
?
PSSM-Id: 179063
View PSSM: PRK00555
Aligned: 14 rows
Threshold Bit Score: 520.187
Threshold Setting Gi: 296138726
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
118466052   1 MTVRYAAPGRINLIGEHTDYNLGFALPIALPQRTVASFTPADDDAITVVSDRADAPVRIPIDTGPGDVTGWAAYPAGVMW 80 
41410170    1 MTVRYAAPGRINLIGEHTDYNLGFALPIALPQRTVASFTRADDDAITVVSDRADAPVRIPIDTGPGDVTGWAAYPAGVMW 80 
15840021    1 MTVSYGAPGRVNLIGEHTDYNLGFALPIALPRRTVVTFTPEHTGAITARSDRADGSARIPLDTTPGQVTGWAAYAAGAIW 80 
15607760    1 MTVSYGAPGRVNLIGEHTDYNLGFALPIALPRRTVVTFTPEHTGAITARSDRADGSARIPLDTTPGQVTGWAAYAAGAIW 80 
148821822   1 MTVSYGAPGRVNLIGEHTDHNLGFALPIALPRRTVVTFTPEHTGAITARSDRADGSARIPLDTTPGQVTGWAAYAAGAIW 80 
148660392   1 MTVSYGAPGRVNLIGEHTDYNLGFALPIALPRRTVVTFTPEHTGAITARSDRADGSARIPLDTTPGQVTGWAAYAAGAIW 80 
253797558   1 MTVSYGAPGRVNLIGEHTDYNLGFALPIALPRRTVVTFTPEHTGAITARSDRADGSARIPLDTTPGQVTGWAAYAAGAIW 80 
183980962   1 MTIRYAAPGRINLIGEHTDYNLGWALPIALPQRAVATFVPDHGDALTASSDLMDGAVRIPLDTVPGGMSGWAGYVAGVIW 80 
118616489   1 MTIRYAAPGRINLIGEHTDYNLGWALPIALPQRAVATLVPDHGDALTASSDLMDGAVRIPLDTVPGGVSGWAGYVAGVIW 80 
224989011   1 MTVSYGAPGRVNLIGEHTDYNLGFALPIALPRRTVVTFTPEHTGAITARSDRADGSARIPLDTTPGQVTGWAAYAAGAIW 80 
118466052  81 ALRTAGHPVPGGAMSITSDVPMGSGLSSSAALECAVLGAISSAAGIRIDATEQARLAQRAENEYVGAPTGLLDQLAALYG 160
41410170   81 ALRTAGHPVPGGVMSITSDVPMGSGLSSSAALECAVLGAISSAAGIRIDATEQARLAQRAENEYVGAPTGLLDQLAALYG 160
15840021   81 ALRGAGHPVPGGAMSITSDVEIGSGLSSSAALIGAVLGAVGAATGTRIDRLERARLAQRAENDYVGAPTGLLDHLAALFG 160
15607760   81 ALRGAGHPVPGGAMSITSDVEIGSGLSSSAALIGAVLGAVGAATGTRIDRLERARLAQRAENDYVGAPTGLLDHLAALFG 160
148821822  81 ALRGAGHPVPGGAMSITSDVEIGSGLSSSAALIGAVLGAVGAATGTRIDRLERARLAQRAENDYVGAPTGLLDHLAALFG 160
148660392  81 ALRGAGHPVPGGAMSITSDVEIGSGLSSSAALIGAVLGAVGAATGTRIDRLERARLAQRAENDYVGAPTGLLDHLAALFG 160
253797558  81 ALRGAGHPVPGGAMSITSDVEIGSGLSSSAALIGAVLGAVGAATGTRIDRLERARLAQRAENDYVGAPTGLLDHLAALFG 160
183980962  81 ALRCAGHPVPGGAMSISSDVEIGSGLSSSAALECAVLGAITSAAGVEIDRIEQARLAQRAENEYVGAPTGLLDQLAALFG 160
118616489  81 ALRCAGHPVSGGAISISSDVEIGSGLSSSAALECAVLGAITSAAGVEIDRIEQARLAQRAENEYVGAPTGLLDQLAALFG 160
224989011  81 ALRGAGHPVPGGAMSITSDVEIGSGLSSSAALIGAVLGAVGAATGTRIDRLERARLAQRAENDYVGAPTGLLDHLAALFG 160
118466052 161 RPAAAVLIDFADLAVTPVAFDPDAAGVALLLIDSRERHTHAGGDYAARRLSCERAAADLSASSLRAAADRGCTDLAAVRD 240
41410170  161 RPATAVLIDFADLAVTPVAFDPDAAGVALLLIDSRERHTHAGGDYAARRLSCERAAADLSASSLREAADRGCTDLAAVRD 240
15840021  161 APKTALLIDFRDITVRPVAFDPDACDVVLLLMDSRARHCHAGGEYALRRASCERAAADLGVSSLRAVQDRGLAALGAIAD 240
15607760  161 APKTALLIDFRDITVRPVAFDPDACDVVLLLMDSRARHCHAGGEYALRRASCERAAADLGVSSLRAVQDRGLAALGAIAD 240
148821822 161 APKTALLIDFRDITVRPVAFDPDACDVVLLLMDSRARHCHAGGEYALRRASCERAAADLGVSSLRAVQDRGLAALGAIAD 240
148660392 161 APKTALLIDFRDITVRPVAFDPDACDVVLLLMDSRARHCHAGGEYALRRASCERAAADLGVSSLRAVQDRGLAALGAIAD 240
253797558 161 APKTALLIDFRDITVRPVAFDPDACDVVLLLMDSRARHCHAGGEYALRRASCERAAADLGVSSLRAVQDRGLAALGAIAD 240
183980962 161 APATALLIDFRDLSLQAVQFDPDAHGVALLLIDSRARHRHAGGEYAARRASCERAAKALHAPSLRDVAE--LSSLTAIGD 238
118616489 161 APATALLIDFRDLSVQAVQFDLDAHGVALLLIDSRARHRHAGGEYAARRASCERAAKALHAPSLRDVAE--LSSLTAIGD 238
224989011 161 APKTALLIDFRDITVRPVAFDPDACDVVLLLMDSRARHRHAGGEYALRRASCERAAADLGVSSLRAVQDRGLAALGAIAD 240
118466052 241 PVDARRARHVLTENGRVIDCVAALNNSDYTEAGRIFTASHASMRDDFGITTERIDLIADTALRAGALGARMTGGGFGGCV 320
41410170  241 AVDARRARHVLTENRRVIDCVAALNNSDYPEAGRIFTASHASMRDDFGITTERIDLIADTALRAGALGARMTGGGFGGCV 320
15840021  241 PIDARRARHVLTENQRVLDFAAALADSDFTAAGQLLTASHESMREDFAITTERIDLIAESAVRAGALGARMTGGGFGGAV 320
15607760  241 PIDARRARHVLTENQRVLDFAAALADSDFTAAGQLLTASHESMREDFAITTERIDLIAESAVRAGALGARMTGGGFGGAV 320
148821822 241 PIDARRARHVLTENQRVLDFAAALADSDFTAAGQLLTASHESMREDFAITTERIDLIAESAVRAGALGARMTGGGFGGAV 320
148660392 241 PIDARRARHVLTENQRVLDFAAALADSDFTAAGQLLTASHESMREDFAITTERIDLIAESAVRAGALGARMTGGGFGGAV 320
253797558 241 PIDARRARHVLTENQRVLDFAAALADSDFTAAGQLLTASHESMREDFAITTERIDLIAESAVRAGALGARMTGGGFGGAV 320
183980962 239 PTDARRARHVLTENRRVHEFVAALRDCDFTAAGRIFTASHASMRDDFEITTEHIDLIADAAVRAGALGARMTGGGFGGCV 318
118616489 239 PIDARHARHVLTENRRVHEFVAALRDCDFTAAGRIFTASHASMRDDFEITTEHIDLIADAAVRAGALGARMTGGGFGGCV 318
224989011 241 PIDARRARHVLTENQRVLDFAAALADSDFTAAGQLLTASHESMREDFAITTERIDLIAESAVRAGALGARMTGGGFGGAV 320
118466052 321 IALAPVQRAEAIGQAVRRAATQAGFAQPVVTRTRAAAGAGPCR 363
41410170  321 IALAPVQRAEAIGHAVRRAATQAGFAQPVVTRTRAAAGAGPCR 363
15840021  321 IALVPADRARDVADTVRRAAVTAGYDEPAVSRTYAAPGAAECR 363
15607760  321 IALVPADRARDVADTVRRAAVTAGYDEPAVSRTYAAPGAAECR 363
148821822 321 IALVPADRARDVADTVRRAAVTAGYDEPAVSRTYAAPGAAECR 363
148660392 321 IALVPADRARDVADTVRRAAVTAGYDEPAVSRTYAAPGAAECR 363
253797558 321 IALVPADRARDVADTVRRAAVTAGYDEPAVSRTYAAPGAAECR 363
183980962 319 IALVAEAGVEAVIAAVHREVRGAGYPPPAISRAHAAAGAGPLR 361
118616489 319 IALVVEAGVEAVIAAVHREVRGAGYPPPAISRAHAAAGAGPLR 361
224989011 321 IALVPADRARDVADTVRRAAVTAGYDEPAVSRTYAAPGAAECC 363
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap