Conserved Protein Domain Family
PRK00553

?
PRK00553: PRK00553 
ribose-phosphate pyrophosphokinase; Provisional
Statistics
?
PSSM-Id: 179062
View PSSM: PRK00553
Aligned: 3 rows
Threshold Bit Score: 588.809
Threshold Setting Gi: 294660546
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13507812    1 MRLnklrhakskkdfplfhlkcslkmaklkwksgwpnlrknlinvkpskvkrssancanNMDRHNHVVFSLSKTHDLVSR 80
gi 108885080   1 MKL--------------------------------------------------------SIDNKKHVIFSLSKSKTLVEN 24
gi 294660546   1 MHV-----------------------------------------------------------KSNHIIFGLSAAKKLTDS 21
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13507812   81 ICQKLKMPMGLITHNEFADGETYIRFEESVRNKDVFIFQSTCAPVNDSLMELLIAIDALKRGSAKSITAILPYYGYARQD 160
gi 108885080  25 ICKKLNISEGKMVCEHFADGETYIRFDESVRNKDIYIFQSTCPNVNDSLMELLIAIDALKRGSAKSITAILPYYGYARQD 104
gi 294660546  22 ICRRLSMKPGEIVIQKFADDEIFVRPDCTLRNKDVVFIQSTNSPVNDNLMELLIAIDSAKRASAKSITALIPYYGYARQD 101
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13507812  161 RKTMGREPITSKLVADLLTTAGVSRVALTDIHSDQTQGFFNIPVDTLRTYHVFLTRTVELLGKKDLVVVSPDYGGVKRAR 240
gi 108885080 105 RKTKGREPITSKLIADMLTKAGANRVVLTDIHSDQTQGFFDIPVDSLRTYHIFLFRVIELLGKKDLVVVSPDYGGVKRAR 184
gi 294660546 102 RKSAGREPITSKLVADLLTKAGVTRATLTDIHSDQTQGFFDIPVDILKASFVLLSHVLVDNKIDDLVVVSPDYGGVKRAR 181
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13507812  241 LIATSLELPLAIIDKRRPAHNVAESINVLGEVANKNCLIVDDMIDTGGTVIAAAKLLREHHAKKVCVMATHGLFNGEAPQ 320
gi 108885080 185 LIANTLELPLAIIDKRRPSHNVAESINVLGEVKNKNCLIVDDMIDTGGTVIAAAKLLQKEQAKKVCVMATHGLFNNDAEQ 264
gi 294660546 182 KIAESINVPLAIIDKRRPKPNVAESINILGEVKNKCCILVDDMIDTGGTIISAAKLLKKQKAKTVLVMATHGLFNKNAIE 261
                        330       340       350       360       370       380       390
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13507812  321 RFQKAFNEGLVDYLFVSNSIPQTK--FDQCPQFQVIDLAPLFEEVLLCYANNSSISAIYTRHIEWIKKHV 388
gi 108885080 265 KFMEAFDQKLIDFLFVSNSIPQYK--FKAVKQFEVVDLASLYEEVVLCYANSLSVSAIYERHIEWIKKHV 332
gi 294660546 262 LFDECYKKKEINKVYIADTIDQTEknLEKKPQFKVVKLDHFYSLVLDKYINGGSISDVYTIYQEWVKSPN 331
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap