Conserved Protein Domain Family
speE

?
PRK00536: speE 
spermidine synthase; Provisional
Statistics
?
PSSM-Id: 134311
View PSSM: PRK00536
Aligned: 11 rows
Threshold Bit Score: 379.203
Threshold Setting Gi: 34558427
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15645451    1 MWITQEITPYLRKEYTIEAKLLDVRSEHNILEIFKSKDFGEIAMLN-RQLLFKNFLHIESELLAHMGGCTKKELKEVLIV 79 
15611838    1 MWITQEITPYLRKEYTIEAKLLDVRSEHNILEIFKSKDFGEIAMLN-RQLLFKNFLHIESELLAHMGGCTKKELREVLIV 79 
108563243   1 MWITQEITPYLRKEYTIEAKLLDVRSEHNILEIFKSKDFGEIAMLN-CQLLFKNFLHIESELLAHMGGCTKKELKEVLIV 79 
188527321   1 MWITQEITPYLRKEYTIEAKLLDVRSEHNILEIFKSKDFGEIAMLN-RQLLFKNFLHIESELLAHMGGCTKKELKEVLIV 79 
208434746   1 MWITQEITPYLRKEYTIEAKLLDVRSEHNILEIFKSKDFGEIAMLN-RQLLFKNFLHIESELLAHMGGCTKKELKEVLIV 79 
210135032   1 MWITQEITPYLRKEYTIEAKLLDVRSEHNILEIFKSKDFGEIAMLN-CQLLFKNFLHIESELLAHMGGCTKKELKEVLIV 79 
254779195   1 MWITQEITPYLRKEYTIEAKLLDVRSEHNILEIFKSKDFGEIAMLN-RQLLFKNFLHIESELLAHMGGCTKKELKEVLIV 79 
298736536   1 MWITQEITPYLRKEYTIEAKLLDVRSEHNILEIFKSKDFGEIAMLN-RQLLFKNFLHIESELLAHMGGCTKKELKEVLIV 79 
109947728   1 MWITQEITPYLRKEYTIEAKLLDVRSDHNILEIFKSNDFGEIAMLN-SQLLFKNFLHIESELLAHMGGCTKKELKEVLIV 79 
161546621   1 MWITRELTSNFRQEYIVDTKILDARSTHTI-EIFKSVDFEEVAMIDkKHLLLKKYIFIESELLAHIPLCSIPAPKNALLF 79 
34558427    1 MWVTRQDSVNFQQEYLIENKILDARSEKNTLEIFKSPAFEEIALLNqKQLLLKTLLSQESELLAHVPLCVHPTPKRVLIA 80 
15645451   80 DGFDLELAHQLFKY-DTHIDFVQADEKILDSFISFFPHFHEVKNNKNFTHAKQLLDLDIKKYDLIFCLQEPDIHRIDGLK 158
15611838   80 DGFDLELAHQLFKY-DTRIDFVQADEKILDSFISFFPHFHEVKNNKNFTHAKQLLDLDIKKYDLILCLQEPDIHKIDGLK 158
108563243  80 DGFDLELAHQLFKY-DTHIDFVQADEKILDSFISFFPHFHEVKNNKNFTHAKQLLDLDIKKYDLILCLQEPDIHKMDGLK 158
188527321  80 DGFDLELAHQLFKY-DTHIDFVQADEKILDSFISFFPHFHEVKNNKNFTHAKQLLDLDIKKYDLILCLQEPDIHKMDGLK 158
208434746  80 DGFDLELAHQLFKY-DTHIDFVQADEKILDSFISFFPHFHEVKNNKNFTHAKQLLDLDIKKYDLILCLQEPDIHKIDGLK 158
210135032  80 DGFDLELAHQLFKY-DTRIDFVQADEKILDSFISFFPHFHEVKNNKNFTHAKQLLDLDIKKYDLILCLQEPDIHKIDGLK 158
254779195  80 DGFDLELAHQLFKY-DTHIDFVQADEKILDSFISFFPHFHEVKNNKNFTHAKKLLDLDIKKYDLILCLQEPDIHKIDGLK 158
298736536  80 DGFDLELAHQLFKY-DTRIDFVQADEKILDNFISFFPHFHEVKNNKNFTHAKQLLDLDIKKYDLILCLQEPDIHRIDGLK 158
109947728  80 DGFDLELAHQLFKY-DTHVDFVQADEKILDSFISFFPHFHGVKNNKNFTHAKQFLDLDIKKYDLIVCLQEPDKHKIDGLK 158
161546621  80 NSFNIEIAYECFKH-NVKVDCVQADKKSLDSLVSFLPHFQQTITHNDFALFTQAMDLDIKKYDVIIADSLLDKHQIDGLS 158
34558427   81 GSFNLEVAFEALRHeETQVDFLQKDEKILHSLISFFPHFQETLHHPRFRVIEEIDSL--KSYEVIIHTSLLSLEEIAPLF 158
15645451  159 RMLKEDGVFISVAKHPLLEHVSMQNALKNMGGVFSVAMPFVAPLRILSNKGYIYASFKTHPLKDLMTPKIEALTSVRYYN 238
15611838  159 RMLKEDGVFISVAKHPLLEHVSMQNALKNLGDFFPITIPFVAPLRILSNKGYIYASFKTHPLKDLMTPKIEALKSVRYYN 238
108563243 159 RMLKEDGVFISVAKHPLLEHVSMQNALKNMGGVFSVAMPFVAPLRILSNKGYIYASFKTHPLKDLMTPKIEALTSMRYYN 238
188527321 159 RMLKEDGVFISVAKHPLLEHVSMQNALKNMGEFFSVAMPFVAPLRILSNKGYIYASFKTHPLKDLMAPKIEALKSVRYYN 238
208434746 159 RMLKEDGVFISVAKHPLLEHVSMQNALKNLGDFFAVAMPFVAPLRILSNKGYIYASFKTHPLKDLMAPKIEALTSVRYYN 238
210135032 159 RMLKEDGVFISVAKHPLLEHVSMQNALKNLGDFFPITIPFVAPLRILSNKGYIYASFKTHPLKDLMTPKIEALKSVRYYN 238
254779195 159 RMLKEDGVFISVAKHPLLEHVSMQNALKNMGDFFAVVMPFVAPLRILSNKGYIYASFKTHPLKDLMTPKIEALKSVRYYN 238
298736536 159 RMLKEDGVFISVAKHPLLEHVSMQNALKNLGDFFAVAMPFVAPLRILSNKGYIYASFKTHPLKDLMTPKIEALKSVRYYN 238
109947728 159 RTLKEDGVFISVAKHPLLEHVSMQNALKNMGEFFSIVMPFVAPLRILSNKGYIYASLKTHPLKDLIAQKIEALKNVGYYN 238
161546621 159 RMLTNEGILIVRSHHPLLEEEVFMQKIREYAPFFKIIMPFFPYLSILGDKSYIFASKHFHPCADMLLQKIDLLPHLHYYN 238
34558427  159 ASLSLDGIFITRLENLLLHTESMRRYLLGIAHHFSIAMPFVSPFSLNADSHFLFASRRFHPQADLLLQRADMLEGLHCYH 238
15645451  239 EDIHRAAFALPKNLQEVFKDNIKS 262
15611838  239 EDIHRAAFALPKNLQEVFKDNIKS 262
108563243 239 EDIHRAAFALPKNLQEVFKDNIKS 262
188527321 239 EDIHRAAFALPKNLQEVFKDNIKS 262
208434746 239 EDIHRAAFALPKNLQEVFKDNIKS 262
210135032 239 EDIHRAAFALPKNLQEVFKDNIKS 262
254779195 239 EDIHRAAFALPKNLQEVFKDNIKS 262
298736536 239 EDIHRAAFALPKNLQEVFKDNIKS 262
109947728 239 EDIHRAAFALPKNLQEILKENIKS 262
161546621 239 AKIHENAFTLPNFIFEKIQDIAKF 262
34558427  239 AELHESAFVLPKFLADSLQGSIKN 262
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap