Conserved Protein Domain Family
polC

?
PRK00448: polC 
DNA polymerase III PolC; Validated
Links
?
Statistics
?
PSSM-Id: 234767
View PSSM: PRK00448
Aligned: 185 rows
Threshold Bit Score: 1757.81
Threshold Setting Gi: 71894029
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15674106    19 KNMENLFEKLMEQIKMPPNLrr------ssQFEHADIENVEVHT---ASKLWHFQLIFDEILPIDTYKLLTELTE----- 84
gi 71894029     3 EYKDVKVKSFANYFNLEFYE----------NLIDIKLLDYSIDQ---NTKKINLSFELDSFPTVNDFFAFIGNLD----- 64
gi 12044881     4 NLENEKDKKVLALSNFLIDNnildhnelnsLIERIESIYFNKYI---EEKVFLFAITISRPLTIDIWNALYEGFNelneg 80
gi 13357937     1 --METKNALFKKIVKISDQL-----------LNKISIKKLTKDK---KNNLFVYFDEFVDVTIIDELHQLSKTTL----- 59
gi 13507773    10 GKRIWALSQFLVKKNILDHNel------hqLNNRIELVYLENDR---ENALFLVALTLKKPLTIDIWNALYEGFQd---- 76
gi 148377333    3 SVGYKRFEAFCKANNIEINS----------ELQGTELVLFNQKYddnSNEKLKIEFRFKNPISYETIKKIKSFIR----- 67
gi 170762156    1 --METKNALFKKIVKISDQL-----------LNKISIKKLTKDK---KNNLFVYFDEFVDVTIIDELHQLSKTTL----- 59
gi 193216948    3 NEFDETFLKLCKEIKFELND----------EFRGTSFKEAKLNK---STHKWTFDIIFPHHISIDNFKDFKTHLD----- 64
gi 269115238    1 -MLDKTFVQLCKEIKFEFDEq---------QFYGAKVLSVESNL-----NEWKFKIAFANHIDIEQYKQFREKLV----- 60
gi 291320001    3 SVGYKRFEAFCKANNIEINS----------ELQGTELVLFNQKYdenSNEKLKIEFRFKNPISYETIKKLKSFIR----- 67
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15674106    85 -----TAFS---TIAR--TEISVSSRNQNIDEQNLNDYYQYALTL---------PELCDSAFSSIFKKY-HLEK-EEEKI 143
gi 71894029    65 ------------NIKDfkVFYSFSFLKINNTESWIEDFLKTACGYlklnelnsvNKVNNQFFYDEFSKSwKISL------ 126
gi 12044881    81 fkadnESFKltiTFKEnePFFKSKNSFSSVTIAIIKDYFHSFFSK---------DKKYKILIEQELSNP-NFLSyENDEL 150
gi 13357937    60 ---------------MhdLQIWYINNLKEVDHKKILTFFKKISEQnan---lifLEQINDLNTKIEYNS------NLNSL 115
gi 13507773    77 ----aEGAElriTFQEdaTFFKDGSTKSSVTLAIIKDYFKSFFGK---------DKKYRILLEQELTHP-NFLSySNHEL 142
gi 148377333   68 -------------LNKdrLDVSFVVSNDSYNKNSILQYVYQIIDK------------------TRFKTLnQINW-ENKFY 115
gi 170762156   60 ---------------MhdLQIWYINNLKEVDHKKILTFFKKISEQ----------NANLIFLEQINDLNtKIEYnSNLNS 114
gi 193216948   65 -----KRFPn--------NNFSFSVRSLIRDKSTIIDYLHYVFLC---------DHSPLLAYKNFFNMD-LVSL-EGDDF 120
gi 269115238   61 -----KRFGk--------VELILAIETIIRNKQIIVDYLNYLIECnpkk-ywpfVKYNYSCITTSAIEI------DEKTL 120
gi 291320001   68 -------------LNKdrLDVSFVVSNDSYNKNSILQYVYQIIDK-----------TRFKPLNQINWEN-KFYV-DEDHI 121
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15674106   144 H-LMVEDNPQ-----MDFFVEKYFPIL-EEKFKSFGFGEVRITPLVDQELtet---qaaAHAEKVAARLA---AQTAEQA 210
gi 71894029   127 --TKTANEIK---------VEKELLKL-NKFLEKIGIDIIYCFIDNKDSAnnsdesdieSSVLNFVQ------NFQEEFE 188
gi 12044881   151 K-AQCQTKEL-----TEWLVQKSKSFI--FWMNNAGFKNFNFIALYPIDK-----------------------NESKLKV 199
gi 13357937   116 I-LKINDKLI-----YDHFIANKLEILnILKVWSLPYSNFEIHFENLSSLl-------nEKHEQAVNEII---SHHIQQQ 179
gi 13507773   143 K-ANCQSQEL-----DQWLIEQRQAFI--KWMHQAGFTHFGFVSLFN-PP-----------------------AEKQLKV 190
gi 148377333  116 VdDNHTGHFEnidrdFENQYGILLSKL-LNKLKEYGFVLLNFSYDYIQSS------------PESYSKSEeaaKQNEKIK 182
gi 170762156  115 LiLKINDKLI-----YDHFIANKLEILnILKVWSLPYSNFEIHFENLSSL--------------LNEKHE---QAVNEII 172
gi 193216948  121 I-LILPNQET-----YDGLKKLENNLKeSLENIGFGFYKIKLKIIEEDTK-----------------KRR---AKKIEAV 174
gi 269115238  121 TlSLLTNEIYevfksNKDLFKEALASI------GFDFYNVVFNLGLNNKK-----------------------SVASKKL 171
gi 291320001  122 G-HFENIDRD-----FENQYGILLSKL-LNKLKEYGFALFNFSYDYIQSS------------PESYSKLEeaaKQNEKIK 182
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15674106   211 QISEIKKQRSEERESKNtreakpefvetalsdgiffgrkisgqspiTSMSFIAGEGFgvifeglvfeaahreftgkesgk 290
gi 71894029   189 TNSPSTFSKNKFRKKQS--------------------------------------------------------------- 205
gi 12044881   200 KAVTVSQYDKQFETKVF--------------------------------------------------------------- 216
gi 13357937   180 KHLEQQISQQQNFYNNQkan-----------------------fnyYKNPS----------------------------- 207
gi 13507773   191 KSMKVSKYDKQFETEVF--------------------------------------------------------------- 207
gi 148377333  183 QELLKKMIELDSSSdky--------------------------dsyNSNPLKVKRNFn---------------------- 214
gi 170762156  173 SHHIQQQKHLEQQISQQqnf-----------------------ynnQKANFNYYKNP----------------------- 206
gi 193216948  175 VENFDKFKKEEANNTPSstsn---------------------qpyrRSKAKAIEMDI----------------------- 210
gi 269115238  172 DGWIEQFNNLKDNENNLkesfs-------------------ksnfySKKESARPIEM----------------------- 209
gi 291320001  183 QELLKKMIELDSSSdky--------------------------dsyDSNPLKVKRNFn---------------------- 214
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15674106   291 vnhilelkmadetstfmiskwgrkdeeiaqfdqivstvkamnekiiadrtdgednftdslsdalwlrvqgniehdkykdd 370
gi 71894029       --------------------------------------------------------------------------------
gi 12044881       --------------------------------------------------------------------------------
gi 13357937       --------------------------------------------------------------------------------
gi 13507773       --------------------------------------------------------------------------------
gi 148377333      --------------------------------------------------------------------------------
gi 170762156      --------------------------------------------------------------------------------
gi 193216948      --------------------------------------------------------------------------------
gi 269115238      --------------------------------------------------------------------------------
gi 291320001      --------------------------------------------------------------------------------
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15674106   371 lvltanavveikpkptidrvalqikavksdkiqlgreikNNEPVTPMRSVSefSTN---GPVVFEGYVFKGELREIKSR- 446
gi 71894029   206 ---------------------------------------REIQFFSIKELNenFSSlekEQISVKGTIYKKELLFKNNN- 245
gi 12044881   217 ----------------------------------------ATEFIPIHKIN--QQI---DDVKIIGQIFELKTHESLTG- 250
gi 13357937   208 ----------------------------------------NKTITKLIDIN--PLM---NNAKIRAYVFLKKIDILKSG- 241
gi 13507773   208 ----------------------------------------STEFVPIHKIN--QQM---DEIKLMGQIFELKDFPGYNNl 242
gi 148377333  215 ---------------------------------------KSYTTYSIKDLAtaPNR---INVEFVGLLFASKKSFSKNK- 251
gi 170762156  207 ---------------------------------------SNKTITKLIDIN--PLM---NNAKIRAYVFLKKIDILKSG- 241
gi 193216948  211 ----------------------------------------KSALNSYADLI-----------TLKGEVFSIDVRKFSSG- 238
gi 269115238  210 ------------------------------------------------DLTtaNETfeeIKITTKGEVFFIESKVLKNK- 240
gi 291320001  215 ---------------------------------------KSYTTYSIKDLAtaPSR---INVEFVGLLFASKKSFSKNK- 251
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15674106   447 KTgnisyLLEFEM--TDYT--SSFYVQKWL-RGE---EEIQLAKQIKAGLWCRVRGNVQR--DNFKNDLVLQL---TDLI 513
gi 71894029   246 -------FEKHNLfiTDYD--DAIKLIASK-SSK---VKNEFLDNLEVGKTFIFYCYVDT--DQRGNKYIQI----TKVN 306
gi 12044881   251 KK-----TLNIYV--TDFQlgGSLILKWSY-------TDEKKIEGITIGNWIKAHIQVER--DPNTQILYGIV---REIN 311
gi 13357937   242 AI-----AYKLNV--IDDS--ETLTIMTYLpSGEh--PLKKFLDELKIDQLIEAEIDIVL--DNMSKSGQVPI---GKIK 305
gi 13507773   243 RN-----TLNIYV--TDFQlgGSLILKWFY-------KDPKTIEGIKIGTWVKATVKVER--DAKTQLLQGII---KEIS 303
gi 148377333  252 KL-----TIQFKV--SDFQ--SAVNCTWFL-DTDwlsNEQKNLINPDNQSWVKVKGSIPSaeKIKGNNFFIYV---DSLE 318
gi 170762156  242 -------AIAYKLnvIDDS--ETLTIMTYLpSGEh--PLKKFLDELKIDQLIEAEIDIVL--DNMSKSGQVPI---GKIK 305
gi 193216948  239 KS-----MASFGL--SDYN--EAIIIKVLL-EDN---EELK----ITNGETVIVTGKLTD--DQYSKTKIVFCgstKNII 299
gi 269115238  241 KI-----LYTLKI--SDYK--EAILVKKFY-------DSENEIPDIKVGDTIIVTGKLSD--DNFTKSKVLIAmgkECFI 302
gi 291320001  252 KL-----TIQFKV--SDFQ--SAVNCTWFL-DTDwlsNEQKNLINPDNQSWVKVKGSIPSa-DKIKGNNFFIYvdsLELT 320
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15674106   514 EIPTQN---VREDKs-DEKRVEFHAHTNMSQMDAIPSASSLVAQAAKWGHKAIAITDHGGLQSFPEAHSAGKKNG-VKII 588
gi 71894029   307 TSPDLR---EYSTDhqKIKRIEFNCKSKNNTLDGLLTPEEIVAEAKRQGHSAVGISDYNSIFSFPEFYYAAKANN-IKPI 382
gi 12044881   312 PVEIPNnykRLDLS--KQKRVELVFHTKMTAFDGINDIEEYAQFAKERGWKAITVTDKDNIHIYPKFYEVAKKYD-LKAI 388
gi 13357937   306 KICCVE---DKHVKkqITPRLELNFHTKMSSLDAIISTQELIDFAVKNQLKTIGITDRNVVQAYPEIAKFSKKQD-LKII 381
gi 13507773   304 PIETPAyyrRPDQD--KQKRVELVFHTKMSAFDGINSVQEYAQFAKERDWKTIAVTDKDNIHIYPTLYEVAKKYG-LKAI 380
gi 148377333  319 LTDSPLn-iKEDIVseDRKRVEFHISTKMNTMDGLFNADDFVERAKRWKMPAVGIMDTDGAQGYPKLFNKAKKAG-IKAI 396
gi 170762156  306 KICCVE---DKHVKkqITPRLELNFHTKMSSLDAIISTQELIDFAVKNQLKTIGITDRNVVQAYPEIAKFSKKQD-LKII 381
gi 193216948  300 VTEGLQ---RLSDDneENKRIEFALRSNMSTQDGISSPSAYLKAAKHFGHRAIAITDLDDVQSFPEFYNATKKDKsVVPI 376
gi 269115238  303 KTEPLQ---KLIEDneDNKRVELAARSNMSAQDGISTPSDYIDAAKFYGHKAIALTDLDDVQGFPEFYNYAKKQKdVKPI 379
gi 291320001  321 DSPLNI---KEDIAseDRKRVEFHISTKMNTMDGLFNADDFVERAKRWKMPAVGIMDTDGAQGYPKLFNKAKKAG-IKAI 396
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15674106   589 YGVEANLVEDKIPIVYNET-D-VDMYESTYVVFDVETTGLSAVHNDLIQIAATKMHKGNPI-DEFDEFINPGYRLSEFTT 665
gi 71894029   383 YGAGFAMLEDTNGAFLTEFqN-QDLITGRYVVFDIETTSLSAYHGEIIEFAATIIENKAVV-DKVDIFIKSKEKLSHFTT 460
gi 12044881   389 YGLEFNLTDDHIKIVHNPD-N-TKLSDATFVIFDIETTGLHGRYDDVIEFSARKIKNNSEI-DHQQFFLKIDKPIPKTIT 465
gi 13357937   382 YGLETEELEDQIPLVLNVR-D-QNLDNATYVIFDIETTGLFPNFDEIIEFGAVIMQNNKQIgEKIQFFIKPIQQINENVT 459
gi 13507773   381 YGLECNLIDDHIKIVSNPD-K-TKLKDATFVIFDIETTGLHGRYDSVIEFAGIKVKHNREV-ERMQFFLKIDGPLPAAVT 457
gi 148377333  397 YGTAFTTINKANEAILGNV-PnGNFKDYSYVSFDIETTGLSPKFHEIIEFGAVDINQDLKVgEVTQFFIKPQAKIGAFTT 475
gi 170762156  382 YGLETEELEDQIPLVLNVR-D-QNLDNATYVIFDIETTGLFPNFDEIIEFGAVIMQNNKQIgEKIQFFIKPIQQINENVT 459
gi 193216948  377 YGATISSISSDNGFFYGTP-AdFDLSSQTYVVFDLETTGLSPRFNEIIEFGASIIENGIIK-ESHQFFIKPTKPIPPSIT 454
gi 269115238  380 YGATLSTIDSDKKFFYNFK-N-FNLKEEEYVVFDLETTGLSPRLDDIIEFGATIVKNNTIT-QKIQFFLQTKRELSAFTV 456
gi 291320001  397 YGTAFTTINKANEAILGNA-PnGNFKDYSYVSFDIETTGLSPKFHEIIEFGAVDINQDLKVgKVTQFFIKPQAKIGAFTT 475
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15674106   666 ELTGITDDHVK-NAKPLYEVLTKFQKFCEGTILVAHNA-TFDVGFMNMNYSRNGLPIITQPVVDTLEFARNLYPEMKRFG 743
gi 71894029   461 RLTSITNEMLDqKGIELKEALQKIYDVLNNNVAVAHNA-NFDYNFLIEKFDQNNMQAPKCTFIDSLVVSRILFEHRDKHN 539
gi 12044881   466 EITKITDEMLE-GGIDQQQGLEKIRNYLDDCVMVAHNGiNFDLPFLQTQFEKYNIKPLTNPLIDTLCLSWALNPLFSSHT 544
gi 13357937   460 NLTNISQEMVN-NAIDEKTALLKIKEIFDDHILVAHNGiNFDINFINQRLLKWGLEPLKNPSIDTLMISRAINP-FKSHR 537
gi 13507773   458 EITKITQAQLE-DGMEQQAGLEKLRAWLDGCVMVAHNGlSFDLPFLQTQFEKYNIAPLTNPLIDTLALSWALNPGFASHT 536
gi 148377333  476 ELTGITQQMLDsEGLSIKDGLQRIYDCLDGKVAIAHNA-KFDFNFLKEQFRLNNVPFPNVTVIDTLIASRIGFPNYKRHK 554
gi 170762156  460 NLTNISQEMVN-NAIDEKTALLKIKEIFDDHILVAHNGiNFDINFINQRLLKWGLEPLKNPSIDTLMISRAINP-FKSHR 537
gi 193216948  455 EITKITDNTVA-NGYSQEEGVRKIYDILKNRICVAHNA-KFDINVCKENFLKYGLDNSKIIGIDSLAIARFLIDEAKSYR 532
gi 269115238  457 ESSHINNEMLK-NGYAQEEGIKKIYEILKDKIAVAHNA-NFDINFCKEKFSKLGLDNSKIFGLDTLALSYFLNPDEFRHS 534
gi 291320001  476 ELTGITQQMLDsEGLSIKDGLQRIYDCLDGKVAIAHNA-KFDFNFLKEQFRLNNVPFPNVTVIDTLIASRIGFPNYKRHK 554
                         810       820       830       840       850       860       870       880
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15674106   744 LGQLTKKFQIGLEHH--HMANFDAEATGRLLFVFLEELR-TRntGWTSLLELNDKLVSEDSYKKVR---PKHVTLYAKTQ 817
gi 71894029   540 LNEFCRNLSVNYDTEkaHRALYDTEVLADAWIEATLKLK-DIk-QISNFQELSEY-KSDALFSKYF---SLYINTVVKNQ 613
gi 12044881   545 LSNICSKLKLEFDDErlHRAEYDTEALKKVFFYFKKQLK-EM--GINTLTEIDQNLNKKCQIDLMKrvfTNTAIVYVKNQ 621
gi 13357937   538 LGAICKKYEVDYNDEsaHRADYDAIVLADVFKVMKNNLFnDF--GITNLSEINTKLQTTMLKNRSF---GNWINLYIKNQ 612
gi 13507773   537 LSNICAKLKFDFDDErlHRADYDTQALKKVFDYFKEQVE-LM--GITNLEQLDQELNQQCHFELLKrtfTNTGIIYIKSQ 613
gi 148377333  555 LEDVTSRLGVVYDPNvaHRGDYDAKVLANVWVNIISELN-SK--NIFTFEDLGNF-TSNDLYAKMH---GYEVSTIALNN 627
gi 170762156  538 LGAICKKYEVDYNDEsaHRADYDAIVLADVFKVMKNNLFnDF--GITNLSEINTKLQTTMLKNRSF---GNWINLYIKNQ 612
gi 193216948  533 LEIVAKKFNVYYARNeaHRADYDANVLANVWILMILKLArEK--NIRTANELAAV-NDDKLFAKKF---PREVRVIAKNQ 606
gi 269115238  535 LGYVAKRFNIIYDTTvaHRGDYDANVLAKIWIKMIDKLAkDY--NILNSQDLNNV-DSQKILSHKF---TYETRILVKNQ 608
gi 291320001  555 LEDVASRLGVVYDPNvaHRGDYDAKVLANVWVNIISELN-SK--NIFTFEDLGNF-TSNDLYAKMH---GYEVSTIALNN 627
                         890       900       910       920       930       940       950       960
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15674106   818 EGLKNLFKIVSFGNVKYYAGLPRVPRSV-LEANREGLLVGSACEIGEVFDAAINKTFEETLEIAKFYDFIEVFPPALYRS 896
gi 71894029   614 AGLKELFQLVSIANTKTFYGAPKIFWST-LKSFKN-ILVGSNGVQGELFDILLLSSRQRVEKYIQKLDYIEIPHPDLFDS 691
gi 12044881   622 RGFQNLYEMLSIALTDHNANRPLVLASS-LAKFRKSFLLTENPVQGDIFKAALTKPINELEKAIEKVDFVLISQPNAYLG 700
gi 13357937   613 ANVKDMYELVSISHTDMYYTRPTITTSF-LANKKDKLIISNSIHESDLINALYSKNDEEIKRLIQRYDFITLPSLGSQKH 691
gi 13507773   614 SGFAKLYELLSIALTDNNATRPLVLTST-LQKFAKSFVITDNPVQGDIFKAALTKPLKELEAAIKRVDFVLIAPPGAYAG 692
gi 148377333  628 KGLKKQFELITDCLTKKFINGPITFKEDfVNLDRSDVLVGSGTLKGLLIDKYFYSSHDDFIKELKHYDFIEIPAPQCFEH 707
gi 170762156  613 ANVKDMYELVSISHTDMYYTRPTITTSF-LANKKDKLIISNSIHESDLINALYSKNDEEIKRLIQRYDFITLPSLGSQKH 691
gi 193216948  607 KGLKKLFKIISKSLTDDYHGGPRLFIDK--WEHDEDLLLGTSTNAGWVWEEAMTGTDENILKALAPYDYIEFPPISTFNY 684
gi 269115238  609 AGLKKLFKIISRSLTSQFKKNPQIYFDQ--LGNDEDLFFGSATNQSYVWDQVFTGTNENLLNSLKYYDYIELPPISSFQY 686
gi 291320001  628 KGLKKQFELITDCLTKKFINGPITFKEDfVNLDRSDILVGSGTLKGLLIDKYFYSSHDDFIKELKHYDFIEIPAPQCFEH 707
                         970       980       990      1000      1010      1020      1030      1040
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15674106   897 LVVGGSFKSEKELEQTLKDLIKIGKTLGKPVLATGNLHYLNPEDAIYREIIVRSLGLGAEINWtqghg-----ehakpLP 971
gi 71894029   692 YLDRNQLTKDQLLESL-QILISLAKKHNKLIISTAEPRYRHKGDREIFKVLT-----SFPIRDkrhflwnykavkagnYS 765
gi 12044881   701 YTLREGLK-KELINDAIKLVIKTATKLKKLVAVASDAYFIHPWENEYYKAIVCAKGLGGKWHRhfnn-------kekeQT 772
gi 13357937   692 LVYAKKI-TIENVQKAFKKLIYLALELNKIIIYSSSPYYFFKDDKKFYDVYVNTKGLEGKAHRfa-----------neVY 759
gi 13507773   693 YTIREGLKKEA-IPNAIKLVVDTAQRLNKLVAVASDAYFIHPWENEYYKAIVCAKGLGGRWHRhfny-------kereQR 764
gi 148377333  708 WIKYGFI-TTKQLHDGLSEIISEAKKHSKICIATADVKYLDPWDKEIFMSLVYAKGIKNARHYlfdykk----aeegkLV 782
gi 170762156  692 LVYAKKI-TIENVQKAFKKLIYLALELNKIIIYSSSPYYFFKDDKKFYDVYVNTKGLEGKAHRfa-----------neVY 759
gi 193216948  685 IYKDDSI-TLEQVQFAYKDLLEKAKKLGKLCIAVSDARYIYDYQSLIYRIYVNAPTLGGGQHWlkk---------yreIA 754
gi 269115238  687 MIDSNHV-TLDELKFLYKDLISKAKSLNKMCVAVSDCRYIYNYQRLIHEIYIEAPTLGGGLHWlk-----------krPS 754
gi 291320001  708 WIKYGFI-TTKQLYDGLSEIISEAKKHSKICIATADVKYLDPWDKEIFMSLVYAKGIKNARHYlfdykk----aeegkLV 782
                        1050      1060      1070      1080      1090      1100      1110      1120
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15674106   972 LPEAHFRTTDEMLEAFSFLDE-KTAREIVIDNTQKMA-DEFD--V-LTPVRDDLYTPKMvfdggETSEERIVRLTYEKAH 1046
gi 71894029   766 VPNFYFLTTDEMLDAFSFLKDkSLIEDIVVNNAHKLN-NLID--EnIEVIKTDLYPPSI-----KNSSELLKDLVYKNAK 837
gi 12044881   773 VPEVFLHTTDEMLKRMSFLGE-DIAYKLVVENTNKIV-KLLDlnE-LVPTKNKLYPPVM-----QDSNQKLIDKTWKQAE 844
gi 13357937   760 VPDLEYIDQKNAIDELAYLEDeKLINLIINENPVHIN-SWFD--DsIQPLKEGLYAPKM-----EGVDQKTIDYVYHTAK 831
gi 13507773   765 VPNVFVRTTGEMLNEMSFLGE-QLAYELVVENTNKLAkQLTA--DdLVPVQTKLQPPVI-----EGSNENLAAKTWSQAK 836
gi 148377333  783 IPNQRFLTTDEMLEQFAFLNDkKLAEEIVIDNTQKIA-NMAE--N-IEVIKTGLFTPEF-----DDSKKKLHDLVYKNAH 853
gi 170762156  760 VPDLEYIDQKNAIDELAYLEDeKLINLIINENPVHIN-SWFD--DsIQPLKEGLYAPKM-----EGVDQKTIDYVYHTAK 831
gi 193216948  755 TPDFKYLTTRQMKDEFKFLNDgTLINEIVVDNTHKLA-EQIT--PkIEVIKDKLYFPTF-----DDSANKLKEVVYQTAK 826
gi 269115238  755 HPEFRYLTTREMLKEFAFLNDsYLINEIVIENPNKIA-NEIS--SnIQVIKDKLYVPTF-----DNSPQKLREVVYRTLK 826
gi 291320001  783 IPNQRFLTTDEMLEQFAFLNDkKLAEEIVIDNTQKIA-NMAE--N-IEVIKNGLFTPEF-----DDSKKKLHDLVYKNAH 853
                        1130      1140      1150      1160      1170      1180      1190      1200
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15674106  1047 EWYGNPLPDIIDARLEKELRSILGNGFSVVYIISQELVKRSNDRGYIVGSRGSVGSSLVATMIGITEVNPLAPHYRCPEC 1126
gi 71894029   838 KKYGEVLPKLVQDRIDKELIPIINYKFDVVYWISHILVKKANDDGYVVGSRGSVGSSLIANLINITEVNPLEPHYICDNC 917
gi 12044881   845 KRYGKNLPKLIKERIEKELNAIISNGFGIVFWISHLLVEQSVKDGYFVGPRGSIGSSLIANLIGISEINPLAAHYLCEQC 924
gi 13357937   832 KIYGENLPTIVEQRIKKELNSIIKHGFSVVYWISHLLVEKSMQDGYGVGSRGSVGSSLVATFLNITDVNPLTPHYLCPNC 911
gi 13507773   837 AIYGDPLPKLIEQRIQEELKAIIDNGFGIIYWISHLLVKQSVQDGYFVGPRGSIGSSLVANLIGISEINPLVPHYLCESC 916
gi 148377333  854 AKYGENLPELIQKRIDSELNPIIKYGFDVIYWISYKLVKLSIDQGFIVGSRGSIGSSFVASLIGISEVNPLVPHYCCPKC 933
gi 170762156  832 KIYGENLPTIVEQRIKKELNSIIKHGFSVVYWISHLLVEKSMQDGYGVGSRGSVGSSLVATFLNITDVNPLTPHYLCPNC 911
gi 193216948  827 ERYGNNIDEKILSRIEKELGPITKYGYSVIYWISHKLVKRSNQDGYLVGSRGSVGSSIVANLAGITEVNPLKPHYLCEKC 906
gi 269115238  827 ERYGDNPDPIIVKRIEKELNPIIKYGYSVIYWISHKLVKKSNEDGYLVGSRGSVGSSIVANLAGISEVNPLPPHYLCKNC 906
gi 291320001  854 AKYGENLPELIQKRIDSELNPIIKYGFDVIYWISYKLVKLSIDQGFIVGSRGSIGSSFVASLIGISEVNPLVPHYCCPKC 933
                        1210      1220      1230      1240      1250      1260      1270      1280
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15674106  1127 QYFECYDDGSFGSGYDMPDKNCPKCDHK--LIKDGHDIPFETFLGFKGDKVPDIDLNFSGDDQPLAHLDVRDIFGEDYAF 1204
gi 71894029   918 KHFEVVNNDKITSGYDLDDKNCPNCDSI--MDKDGHSIPFETFLGFKADKVPDIDLNFSGEYQIAIHNYTRELFGEDKTF 995
gi 12044881   925 HYFEV--SDSVDDGYDLMIRDCPKCHEKasFKGDGHNIPFATFMGFSGDKIPDIDLNFSSEYQAKAHDYVRKLFGVNNTF 1002
gi 13357937   912 KKCEFITNAD--DGFDLAPKSCEQCQTP--MLTDGHNIPFETFLGFDGDKVPDIDLNFSGVYQAVAHNFIKSIFGETHSY 987
gi 13507773   917 QYFEV--NEEVDDGYDLMVRDCPKCGAKaaFKGDGHNIPFATFMGFAGDKIPDIDLNFSSEYQAKAHAYVRELFGEQYTF 994
gi 148377333  934 KHFEIANVSGITSGYDLPDKTCPQCHTK--IKGDGQSIPFETFLGFNADKVPDIDLNFTGEFQGVVHEEILKLFGESHTF 1011
gi 170762156  912 KKCEFITNAD--DGFDLAPKSCEQCQTP--MLTDGHNIPFETFLGFDGDKVPDIDLNFSGVYQAVAHNFIKSIFGETHSY 987
gi 193216948  907 KHFEWSEDPHIFSGWDLPDKKCPKCATI--MLKDGHDIPFETFLGFEANKVPDIDLNFSGEYQVTIHNYVKELFGEAHTF 984
gi 269115238  907 KYFEWNSNKEIYSGWDLPDKHCPNCNSI--LSKDGHNIPFETFLGFEADKVPDIDLNFSGEYQPTIHNYVKELFGEAHTY 984
gi 291320001  934 KHFEIANVPGITSGYDLPDKICPQCNTK--IKGDGQSIPFETFLGFNADKVPDIDLNFTGEFQGVVHEEIRKLFGESHTF 1011
                        1290      1300      1310      1320      1330      1340      1350      1360
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15674106  1205 RAGTIGTVAEKTAFGFVKGYERDYD----QFYGNAEIDRLAAGSTGVKRTTGQHPGGIIVIPNYMDVYDFSPVQFPADDV 1280
gi 71894029   996 RAGTVSSIQYRKAFGFIKKYIEDTN----TFYSNGFIDYLAEKCIDVKVTTGKHAGGIVVLPENLDIEEFTPVNYASDGL 1071
gi 12044881  1003 RAGTIATVAEKTAYGYARNYFEIIKr--vDLATTAEIERFKQKLIGIKRTTGQHPGGIMIFPSDHSVYEFTPCGFPADDV 1080
gi 13357937   988 RAGTIGTMAQTSAENTVKKYFENRFne-nKIIRDSTVSLYVQKCIDSKRTTGQHPGGIIIVPKEYSIWDFSPYNFPANDI 1066
gi 13507773   995 RAGTIATVAEKTAYGYARNYFEIIKq--tELATAPEIERFKQKLVGIKRTTGQHPGGIMIFPNHKSVYEFTPCGYPADDT 1072
gi 148377333 1012 RAGTISKVAEKTAFGYVKSYAEQTR----QNIPQIFVEFLANRIKDVKRTTGQHPGGIIIIPKQFDIFDFTPINYPANDQ 1087
gi 170762156  988 RAGTIGTMAQTSAENTVKKYFENRFne-nKIIRDSTVSLYVQKCIDSKRTTGQHPGGIIIVPKEYSIWDFSPYNFPANDI 1066
gi 193216948  985 RAGTIATIASKTAYGFCRKYDEEIHslheEPWTRTFLDFLASKTEGVKRTTGQHPGGIIIIPKEFDVEDFTPVNYPANDI 1064
gi 269115238  985 RAGTIATVAEKTAYGFCKKYEEEKRgn-yQPWSHLFLDFLASKTQGVKRTTGQHPGGIIIIPKEFDVEDFTPVNYPANDT 1063
gi 291320001 1012 RAGTISKVAEKTAFGYVKSYAEQTR----QNIPQIFVEFLANRIKDVKRTTGQHPGGIIIIPKQFDIFDFTPINYPANDQ 1087
                        1370      1380      1390      1400      1410      1420      1430      1440
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15674106  1281 -NAEWQTTHFDFHAIHDNILKLDILGHDDPTMIRKLQSLSGIVPQDIPMDDPGVMKLFTGTESLGLT-EEQLGVK-LGTL 1357
gi 71894029  1072 eDKEWKTTHFKYDFLKENLLKLDLLGHSDPTQIRFLEQATGLLSKNIPKKDKNLLKLFSSTEPMEID-PNDINGEtTGAI 1150
gi 12044881  1081 -ESEWKTTHFEYDALGDAILKLDILGQDDPTMLKHLADLTKINPQNIPHFDKNLISMFSSNKPLNLK-PGIVDEV-TGAV 1157
gi 13357937  1067 -NETWKTTHFAFEYLHDSLLKFDILGHDNPTILKLLKDYTGIDERDVPMYDPLVMKSFSDISALNIKpSDVLNET-TGAI 1144
gi 13507773  1073 -SSDWKTTHFEYDALGNTILKLDILGQDDPTMLKHLGDLTHVNPQNIPRFDKKLTEMFWSVNPLKLK-PHYLDEP-TGAI 1149
gi 148377333 1088 -SSSWLTTHFDYKAIHDNVLKFDILGHDNPTSIKLLEQYTGINIYDVPKNDESVIKLFSSTEPMGIK-PDQISNEkTGAI 1165
gi 170762156 1067 -NETWKTTHFAFEYLHDSLLKFDILGHDNPTILKLLKDYTGIDERDVPMYDPLVMKSFSDISALNIK-PSDVLNEtTGAI 1144
gi 193216948 1065 -TSAWKTTHFDFTSIHDNVLKLDLLGHDDPTVIRMLEDLTKTDAKKIPKFDEKVMSLFSSTEAIKIN-PSEISNEtTGAY 1142
gi 269115238 1064 -ESSWKTTHFDFTSIHDNVLKLDLLGHDDPTVIRMLETLTNTNAKEIPKFDAEVMKLFYTTESLKIS-PSDIGGEtTGAY 1141
gi 291320001 1088 -SSSWLTTHFDYKAIHDNVLKFDILGHDNPTSIKLLEQYTGINIYDVPKNDESVIKLFSSTEPMGIK-PDQISNEkTGAI 1165
                        1450      1460      1470      1480      1490      1500      1510      1520
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15674106  1358 GIPEMGTFTSMNMIAEAKPKNFADLLQISGLSHGTDVWSGNAQDLIRSGIADLSSVIGCRDDIMVYLIHKGLENGLAFTI 1437
gi 71894029  1151 ALPEFGTKFTREIIKTSKPHLFADLISISGLSHGQNVWKNNAEDLILNENKTLNEIVCCRDDIMNYLIKKGVDASLSFKV 1230
gi 12044881  1158 GIPEFGTKFVRKILEQTKPKDFADLIRVSGLSHGKNVWADNAQKLIKSNRLTLRDVIACRDDIMLYLINKGMQAKDAFEI 1237
gi 13357937  1145 SIPEFGTRFVRGMLVDTKPKSFADLIRISGLSHGESVWLGNAQSLIKSGKL-LKDVIACRDDIMTYLIRQNVEPKTAFLI 1223
gi 13507773  1150 GIPEFGTKFVRKILEQTKPKGFGDLIRVSGLSHGKNVWADNAQKILKDQNLSLKDVIACRDDIMLYLIHKGMQAKDAFEI 1229
gi 148377333 1166 GLPEFGTSFVRQMLNDIKPKTVADLISISGLSHGTNVWINNADELVLEKGRKLNEVVCCRDDIMPMLIAKGIEPLMSFTL 1245
gi 170762156 1145 SIPEFGTRFVRGMLVDTKPKSFADLIRISGLSHGESVWLGNAQSLIKSGKL-LKDVIACRDDIMTYLIRQNVEPKTAFLI 1223
gi 193216948 1143 GLPEFGTTFVRRMLKTAKPKSFNDLILMSGLSHGTDVWSGNAEELIKQG-KKLQDCVCCRDDIMRDLINWNIDHLEAFEI 1221
gi 269115238 1142 GLPEFGTNFVRKMLKKAQPRSFNDLILLSGLSHGTDVWTDNAEELVARG-KKLIECVCCRDDIMRGLIEWNIEPLTAFQI 1220
gi 291320001 1166 GLPEFGTSFVRQMLNDIKPKTVADLISISGLSHGTNVWINNADELVLEKCRKLNEVVCCRDDIMPMLIAKGIEPLLSFTL 1245
                        1530      1540      1550      1560      1570      1580      1590      1600
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15674106  1438 MERVRKGMwnkipaEEREKYVEAMREHDVPEWYIESCSKIKYMFPKAHAAAYIMMALRVAYFKVHHPILYYCAWFSIRAT 1517
gi 71894029  1231 TESVRKGK------GVDSEDIKILSTYNIPDWFFDSMQKIKYMFPRAHAVAYVIMAWRMGYYKLYYPLEFYASFFSVKCS 1304
gi 12044881  1238 MEKVRKGI------KVNAKEVSLMQNCGVEQYWINACLKINYLFPKAHAAAYVLMAWRIAWFKLYHPLSYYACLLSFKLK 1311
gi 13357937  1224 MEDVRKGK------KIKPEHQIILKELKVPEWYIESANKIKYMFPKAHATAYVMHAWKFAWYKIYYPLEYYAAFFSVRAD 1297
gi 13507773  1230 MEKVRKGI------ALNAKEVQLMQSNGVEQHWINSCLKISYLFPKAHAAAYVLMAWRIAWFKLYHPLSYYACLLSFKLK 1303
gi 148377333 1246 MEKVRKGK------GLSNEEVGLLEKHNVPDWLIKSMQKIEYLFPKAHATAYVTMALWIAWFKLYEPLAFYASYFTAHSK 1319
gi 170762156 1224 MEDVRKGK------KIKPEHQIILKELKVPEWYIESANKIKYMFPKAHATAYVMHAWKFAWYKIYYPLEYYAAFFSVRAD 1297
gi 193216948 1222 MEKVRKGK------GLSEYQESLLQSKNVPIWYIESLKKIKYMFPKAHATAYVIMAWRIAWYKFYYPLQFYASFYSTRPD 1295
gi 269115238 1221 MEKVRKGK------GLTPEWEELLKSHNVPEWYIESLQKIKYMFPKAHATAYVIMAWRIAWYKLYYPLPFYASFYTNRPD 1294
gi 291320001 1246 MEKVRKGK------GLSNEEVGLLEKHNVPNWLIKSMQKIEYLFPKAHATAYVTMALWIAWFKLYEPLAFYASYFTAHSK 1319
                        1610      1620      1630      1640      1650      1660      1670      1680
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15674106  1518 AFDIGVMGA--G--LEAVKAKMKEI--K----DKGFDATNVETNLYTTLELCNEMLERGFTFGKIDLYRSEATEFVI--D 1585
gi 71894029  1305 KFDLSAMIDfsKdgYWKIKNKIEEIekLi--rTNNKKDNKKEEDILESLNVALEMYSRGFTIQNIDIEKSDAYNWIIdkD 1382
gi 12044881  1312 EHDINGFEK--G--YEFIKNRLDELnkL----YRIKKIKPKEAELLTSYEVYLEMMARNIKLQQISIQNSNARMFVE--H 1381
gi 13357937  1298 NFDLFVINQ--G--KEFIEKTYNDIeqRsksrDPQKKVSSRELALQPIYEIVIELLARGFKISNISIEQSQATSYVIdkE 1373
gi 13507773  1304 EHDVSGFKS--G--VSFVKQKLEELntL----YRIKRIKPKEAELLTSYEVYLEMMARGIKLEQISLTHSHATRFVE--H 1373
gi 148377333 1320 ADDIENMIDkpN--GIKVSKRLYEL-------KKTEDRSNKENDLIGVFEVAEELYARGFYISNVDIDKSQAEKWLIdkE 1390
gi 170762156 1298 NFDLFVINQ--G--KEFIEKTYNDIeqRsksrDPQKKVSSRELALQPIYEIVIELLARGFKISNISIEQSQATSYVIdkE 1373
gi 193216948 1296 AIDIKVMSD--G--KDAVDNKLLELkkRsd-sKK-EPLSTKETNLIPILEITQELYARGFKITNVHISKSKAARWIVdiE 1369
gi 269115238 1295 AIDIQIMSS--G--AASVHQKLIELknRq--nSTGEKLSVKEEALIPVLEITQELYARGFKIKNVDLKLSLADKWIIdeK 1368
gi 291320001 1320 ADDIENMIDkpN--GIKVSKRLYEL-------KKTEDRSNKENDLIGVFEVAEELYARGFYISNVDIDKSQAEKWLIdkE 1390
                        1690      1700      1710      1720      1730      1740      1750
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15674106  1586 GDTLIPPFVTMDGLGENVAKQIVAARAEGEFLSKMELRKRGGVSQTIIENMTNMGVLEGMPD-DNQLSLF 1654
gi 71894029  1383 SKSLIPPFSALDGIEAGAIK-IINARKERPFKTVLDFAKRSGVSSTIVEKLKELNVFKDLPE-SEQLSLF 1450
gi 12044881  1382 NGVLIAPFITIPGMGEAVASSIVEARNEKPFASLNDFKKRTKITKKHVETMEQLQLFDEFEH-QDDHKLF 1450
gi 13357937  1374 NNAIIPPFIAIQGLGETVANSIIEARNQKVFSTIEDLKNRTKISRTDLKNLRVLGVLDHLSE-TEQLTLF 1442
gi 13507773  1374 NGMLIAPFITIPGMGEAVANSIIEARNEKPFSSLDDFKKRTKITKKHIEAFTQMQLLDEFREqDNQKKLF 1443
gi 148377333 1391 RGCLIPPFSTIESLGSVKANDIVNARAEKAFLSKEDFKIRTGVSKTVFDTMNRMKILDSLND-SDQLTLF 1459
gi 170762156 1374 NNAIIPPFIAIQGLGETVANSIIEARNQKVFSTIEDLKNRTKISRTDLKNLRVLGVLDHLSE-TEQLTLF 1442
gi 193216948 1370 NKALIPPFVVVEGLGETVADSIIQARNEHEFLSVEDFEKRTKVNSKIASQLKLLGILDELDE-TNQNSLF 1438
gi 269115238 1369 DKALIPPFNVVDGLGITVAQTIVSARKEGFFLSIEDLASRTKVNSRIISELKKIGVLDCLDD-TNQVSLF 1437
gi 291320001 1391 RGCLIPPFSTIESLGSVKANDIVNARAEKAFLSKEDFKIRTGVSKTVFDTMNRMKILDSLND-SDQLTLF 1459
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap