Conserved Protein Domain Family
metG

?
PRK00133: metG 
methionyl-tRNA synthetase; Reviewed
Statistics
?
PSSM-Id: 234655
View PSSM: PRK00133
Aligned: 417 rows
Threshold Bit Score: 792.43
Threshold Setting Gi: 189026023
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189026023   1 MTRKLITAALPYVNNVPHLGNLIQGLSADVFARFCRMRGYHTCFVCGTDEYGTASETRAAEQGLSPAQLCAHYHALHRDI 80
gi 15789599    9 DDPAVVTCGLPYPTGDLHIGHLRTYVSGDAFSRALRKLGQETVFVSGTDMHGTPIAVQAIEAGVGPLDLGLERHEQYADT 88
gi 169235311   9 DDPAVVTCGLPYPTGDLHIGHLRTYVSGDAFSRALRKLGQETVFVSGTDMHGTPIAVQAIEAGVGPLDLGLERHEQYADT 88
gi 292654972   9 ENPAVVTCGLPYANGDLHIGHLRTYVGGDIYSRSLRTLGQQTAFVSGSDMHGTPVAVNAEKEGVTPEEFALRHHEKYEAT 88
gi 222478882   9 DDPAVVTCGLPYANGDLHIGHLRTYVGGDVYRRALERLGQETAFVSGSDMHGTPVAVNAEQEGVSPEQFALDWHEQYAAT 88
gi 289582256  15 DRPAVVTCGLPYANGDLHIGHLRGYIGADAFSRALETLGQETAYVSGSDMHGTPVAVNAEEEGVSPEEFAMEWHEQYEET 94
gi 76801248    8 ETPAVVTCGLPYANGDLHVGHLRTYVSGDAYARALESLGQSVAFVSGSDMHGTPIAVNAAEEGVDPESFAVEYHEQYEET 87
gi 284164098  11 DQPAVVTCGLPYANGDLHIGHLRGYIGADAFSRALETLGQETAYVCGSDMHGTPVAVNAEQQGVDPEDFALDWHEQYEET 90
gi 257053975   9 ENPAVVTCGLPYANGDLHIGHLRTYVGGDVLTRSLEKLGQQTAFVSGSDMHGTPIAVQAIEDDIDPEAFALEYHEQYEET 88
gi 300711986   9 DHPAVVTCGLPYANGDLHIGHLRTYVSGDTLARSLRRLGQQTAFVSGSDMHGTPVAVNAEREGITPEEFALEYHEEYAET 88
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189026023  81 YQWFDLSFDYFGRTTSDAHTELTQALFRHLDARGFISEHESAQAYCLHCARFLADRYLRGTCPHCRNAeARADQCEH-CG 159
gi 15789599   89 FEEFSVAFDTYGHTDEETNVELTREFVGAWEDNDHVYETEIQVAYDPDADQWLPDRYVEGTCPYCGEH-ARGDECDEgCQ 167
gi 169235311  89 FEEFSVAFDTYGHTDEETNVELTREFVGAWEDNDHVYETEIQVAYDPDADQWLPDRYVEGTCPYCGEH-ARGDECDEgCQ 167
gi 292654972  89 FPRFNIEFDNYGHTHDETNTELTQEIVRTLEAEGYVYEKEIPVAYDPDADQWLPDRFVEGACPYCGAH-ARGDECDEgCG 167
gi 222478882  89 FPKFNVEFDNYGHTHDETNTAVTQQLVRDLDEGGHLYEKEIMVAYDPVDDQFLPDRYVEGTCPYCGAH-ARGDECDEgCQ 167
gi 289582256  95 FPKFNVDFDNYGHTHDETNTEFTQEIVRTLDDEGYVYEKEIQVAYDPDADQYLPDRYVEGTCPYCGEK-ARGDECDEgCQ 173
gi 76801248   88 FPQFNIEFDNYGHTHDETNTEMTRSFVRSWIDDDHVVEKEIEVAWDAEADQPLPDRFVEGTCPYCGEK-ARGDECDEgCQ 166
gi 284164098  91 FPQFNVEFDNYGHTHDETNTELTQEIVRTLDEEGYIYEKEIQVAYDPDADQYLPDRYVEGTCPYCGEK-ARGDECDEgCQ 169
gi 257053975  89 FPEFDVDFDNYGHTHQETNRELTHEIVEALEAAGYVDEQEIKVAWDPEDDQPLPDRYVVGTCPYCGET-ARGDECDEgCG 167
gi 300711986  89 FPEFGVEFDNYGHTHDETNTELTREFVREWIDNGHVYEKEIQVAWDPEVDQPLPDRYVEGTCPYCGEK-ARGDECDEgCQ 167
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189026023 160 VLLEPETLLNARCVSCGTAPEFRPTRHLYLNLPALEKAYRSWfcTTnHLWTKNAVRMTEGWLRTGLQERAITRDLRWGVP 239
gi 15789599  168 RHLEPGEIEAPVSTITGNSAEYHERAHKFLRLSDFQEYLEGFi-NR-MEGTNNAKNQPREWIEGGLEDFCITRDLDWGID 245
gi 169235311 168 RHLEPGEIEAPVSTITGNSAEYHERAHKFLRLSDFQEYLEGFi-NR-MEGTNNAKNQPREWIEGGLEDFCITRDLDWGID 245
gi 292654972 168 RHLEPGEIEDPTSTLTGNPAEYREREHKFFAVSDLQDYLQEFi-DR-LEGTSNARNQPREWIEGELQDWCITRDMDWGID 245
gi 222478882 168 RHLEPGEVEDPESTITGNPAEYRERTHQFFEVSAFSEYLSGFl-DR-LEGTSNARNQPREWIEQGLQDWCITRDMDWGID 245
gi 289582256 174 RHLEPGEVEDPTSTITGNAAEYRDRTHKFFEVSEFADYLTEFl-DG-LEGTSNARNQPRQWIEEGLQDWCLTRDMEWGID 251
gi 76801248  167 RHLEPGEIEAPVSTITGNPAEYRTRPHKFLRLSDFQEYLRGFi-DR-LEGTENAQNQPREWIEGELQDLCITRDMDWGID 244
gi 284164098 170 RHLEPGEVEDPTSTITGNPAEYRERTHKFFEVSEFADFLTEFl-DG-LEGTSNARNQPRQWIEDGLQDWCITRDMDWGID 247
gi 257053975 168 RHLEPGEIEDPVSKISGNPAEYRERTHKFFEVSKLADYLSGFl-DR-LEGTANAKNQPRQWIEEGLQDWCITRDMDWGFD 245
gi 300711986 168 RHLEPGEIEDPTSTLTGNPAEYRTREHEFLRLSDFQEYLKGFl-GR-LEGTDNAKNQPKEWVEGELQDLCITRDMDWGIE 245
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189026023 240 VPkaG-------------------------------FEQKVFYVWFDAPVGYISITKCGTEAassqegggtddGVkE--- 285
gi 15789599  246 YP--Ge-----------------------------gGDDLVLYVWVDAPIEYVAATKQYSERv---------gTEeF--- 282
gi 169235311 246 YP--Ge-----------------------------gGDDLVLYVWVDAPIEYVAATKQYSERvg---------tEeF--- 282
gi 292654972 246 YP--GvsesaedseadqtesgrdegdesdgssspsgTSDLVLYVWVDAPVEYVSSTKQYTERv---------gADtF--- 311
gi 222478882 246 YP--Ge-----------------------------nPQDLVLYVWVDAPIEYISSTKQYTERvg---------aDaF--- 282
gi 289582256 252 YP--Ngds--------------------------etTEDIVLYVWVDAPVEYIASTKQYADRvg---------tDeY--- 291
gi 76801248  245 YP--Adgd--------------------------esGEDLVLYVWVDAPIEYVSSTKQYSEQv---------gRDeY--- 284
gi 284164098 248 YP--Taeg--------------------------edESELVLYVWVDAPIEYVASTKQYSER------------VgTdef 287
gi 257053975 246 YP--Evddt-----------------------gddtAEDLVLYVWVDAPIEYIASTKQYTDRv---------gPEaY--- 288
gi 300711986 246 YP--Ee-----------------------------gKEDLVLYVWVDAPIEYVASTKQYTERvg---------eEvF--- 282
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189026023 286 KWQSWWLd------QQD--VELVQFVGKDNIPFHTLFFPCMLIGsgQRWTMLTRLSATEYLNYEGGKFSKSLGVGVFGSD 357
gi 15789599  283 DWASVWK-------DGD--GEIIHVIGRDIIQHHTVFWPSMLAG--ADYAEPRAVCATGFVNIDGRGLSTSKNRAIWAAE 351
gi 169235311 283 DWASVW--------KDGd-GEIIHVIGRDIIQHHTVFWPSMLAG--ADYAEPRAVCATGFVNIDGRGLSTSKNRAIWAAE 351
gi 292654972 312 DWEVAWK--------DA--GDIVHIIGRDIIQHHTVFWPAMLRG--AGYVEPRAVMASGFITLNGKGFSTSRNRAVWADE 379
gi 222478882 283 DWEAAWKega--sdAHPegGEIVHVIGRDIIQHHTIFWPAMLEA--TDHTEPRAVMASGFVTLGGKGFSTSRDRAVWADE 358
gi 289582256 292 DWERVW--------KDD--GDIVHVIGRDIIQHHTIFWPAMLEG--AGYNKPRAVAATGFITINGKGLSTSRNRAIWAKE 359
gi 76801248  285 DWEAVWKnqvdgvpPEG--GEIVHIIGHDIIQHHTVFWPAMLRG--AGFNEPRAVMACGFVNLDGDAFSTSRNRAVWADD 360
gi 284164098 288 DWEQVWK-------GD---GEIMHIIGRDIIQHHTIFWPAMLEG--VGYNKPRGIAATGFITINGKGLSTSRNRAIWAKE 355
gi 257053975 289 DWAETWK--------ES--GEIIHVIGRDIIQHHTIFWPAMLHV--AEFNEPRAVVASGFMSLDGDAFSTSRNRAIWARE 356
gi 300711986 283 DWAEPW--------KEGd-GELIHVIGRDIIQHHTVFWPSMLRG--ADYNEPRAVMASGFVNLDGKAFSTSRNRAIWADD 351
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189026023 358 AKESgIPSDLWRFYLLYHRPEKSDAHFTWHEFQERVNSELIGNLCNLVNRTLTFVARTYgGVVPaqdgar----straqV 433
gi 15789599  352 YLDAgFHPDLLRYYLATASGFERDVNFSWAEFAQRVNTELADAVGNFAYRALLFANRNF-DGTPq--------------E 416
gi 169235311 352 YLDAgFHPDLLRYYLATASGFERDVNFSWAEFAQRVNTELADAVGNFAYRALLFANRNFdGTPQ---------------E 416
gi 292654972 380 YLDEgFHPDLLRYYLATNGGFQQDVDFSWSKFKDRVNSELVGTVGNFLYRSMLFAYRNF-EGTPdvselhseasetgsrA 458
gi 222478882 359 YLDEgFHPDPLRYYLATNGGFQQDVDFSWEKFRDRVNTELVGTVGNFLYRSLLFAHRNYdDAPI---------------A 423
gi 289582256 360 YLEEgFHPDLLRYYLTTTGGLQQDVDFSWDAFQEKVNGELVGTVGNFWYRSLLFAYRNYeGT-P---------------E 423
gi 76801248  361 YIESgLHPDLYRYHIITGSEFTADVDFSWDGLQERTNSELVGTLGNFLYRSLLFAERNY-GGTP---------------D 424
gi 284164098 356 YLDEgFHPDLLRYYLTTTGGLQQDVDFSWDAFQEKVNGELVGTVGNFWYRSLLFAYRNYeGT-P---------------E 419
gi 257053975 357 YLDEgFHPDLLRYYLTTVGGFQDDIDFSWDRFRERVNGELVGTVGNFAYRSLLFADRNY-GGTP---------------D 420
gi 300711986 352 YLAEgFDPDLLRYYLVTTGGFQQDVDFSWERFQERVNGELVGNFGNFVYRSLLFAHRNFeGT-P---------------S 415
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189026023 434 MEETLALREAVRNTAKRMTDLMEQVQLREAFREVFALSARANKALQDGAPWKTRAQDRERADALMRELCYVIRDVLILAH 513
gi 15789599  417 VSLTDDVETEIAQAMDDYEDALNEYDLRTAGERAVALARFGNEYIQHNEPWNLDSe---aAAPVMRDCVQLVKAVAVLLQ 493
gi 169235311 417 VSLTDDVETEIAQAMDDYEDALNEYDLRTAGERAVALARFGNEYIQHNEPWNLDSe---aAAPVMRDCVQLVKAVAVLLQ 493
gi 292654972 459 AEVSEEVEARIEEAIDEFEAGINDYSVRKSGNAAVRLAQFGNEYIQRNEPWKLTDEDPEAAAQVIRDCVQIAKAIAVLFF 538
gi 222478882 424 DATSDEVAERIEEAIADFEAAVNDYSVRAVGDAVTDLARFGNEYIQRSEPWKLVDDDPEEAAQVIHDCVAIAKAIAVLFE 503
gi 289582256 424 ADVSEEVAERIKGAIGQTREAVNDYSLRGIGQAATQLAQFGNEYIQRNEPWKLTDDDPEQAAQVIRDCVQIAKAVGVLLE 503
gi 76801248  425 AAVSDEVRNEIEAAMADFRTAVNDYRVRGLGRAPVELATFGNEYIQRHEPWKLTDDDPEKARQVIRDCVQIAKAIAVLAE 504
gi 284164098 420 TDVSEEVRERIEGAIGDARESVNDYDLRGIGGAATELAQFGNEYIQRNEPWKLTDDEPEKAAQVIRDCVQIAKAVGVLIE 499
gi 257053975 421 ADLSPDVEDRIEDAIEDFEAGVNDYSIRKATQAAVELASFGNEYIQRHEPWNLDDd---eAAPIIRDCVQIAKAVAVLLQ 497
gi 300711986 416 ADVSEEVRTEINAAMEAFRRDLNEYSLREASQAGIRLSRFGNEYIQRNEPWKLVDEDPEEAARVIRDCVQLAKAAAVLLE 495
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189026023 514 PFLPWYTQQAARFLGVqlsscapegggavcaakkdadtaQpdtvqptLRWSD---------------VGERK-GLTQVHP 577
gi 15789599  494 PFLPEKTETLWAQLGEdgr-----------------vsdA-------TIADC---------------LQAPP-AEFGEPA 533
gi 169235311 494 PFLPEKTETLWAQLGEdg-------------------rvS-------DATIA---------------DCLQA-PPAEFGE 531
gi 292654972 539 PVAPGKMQAL---------------------------------------WEQlgedgsvadtgvddaFEAPP-ASFGEPE 578
gi 222478882 504 PIAPEKTERLWDQLGEd----------------------G-------SVHET---------------TVEAA-REGPAGD 538
gi 289582256 504 PIAPDKAQALWEQLGEdgdvsd------------vhledA-------LESPP-----------------------RNFDE 541
gi 76801248  505 PVLPGKAAAL---------------------------------------WDQlgedgsvhdaelgaaLESPP-EAFDEPD 544
gi 284164098 500 PIAPDKAQNL---------------------------------------WEQlgedgavadahledaLEAPP-RNFDEPG 539
gi 257053975 498 PTTPDTSRRLWAQLDEdgs------------------iaD-------VTLDA---------------ALESPpAEFGEPT 537
gi 300711986 496 PILPHAAERLWAQFGEa----------------------E-------SVHDT---------------RLEDS-LEAPPTE 530
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189026023 578 ---PVILFRPLETETIAAYRARYAGtardgagvsv--------prtaqmptgMNKKETDAQQKKEEREMPPP-------- 638
gi 15789599  534 -----ELFEKIEDDRVTELDEALAAkieaass-------------edadgegMADETADDGIELEPLAEDD--------- 586
gi 169235311 532 ---PAELFEKIEDDRVTELDEALAAkieaassedadg------------------egmadetaddgIELEPL-------- 582
gi 292654972 579 -----ALFEKIEDERVEELNEKLEArvaetese------------sdesdgdAEEDMDADTDADADIDFEPI-------- 633
gi 222478882 539 laePTELFEQIEDERVEALNEKLEAraaeae---------------dgdeadEESGDDGEADDGSDEADDDTtdepdmtd 603
gi 289582256 542 ---PGELFEKIEDDRVAELNEKLEErvaaagdddesddneetesddtasdesAAMADEDEGEDAATGDLEPLl------- 611
gi 76801248  545 -----ELFEKLEDDRIEELNRQLEEriea--------------------adaGDEEGEDEDEEPPAADLEPV-------- 591
gi 284164098 540 -----ELFAKIEDDRVEELNEKLEErvaaa-----------------gdddgEDADEETESDDTAADESDSMadtddlea 597
gi 257053975 538 -----ELFEKIPAERVEALNEKLEArvaeatd--------------sddadgETESDDSEEAETADMDLEPL-------- 590
gi 300711986 531 fgePEALFEKVEDERVTELNEKLQErvaaasa-------------aassedeDTGGETDEDTSGLESLAEER-------- 589
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189026023 639 --SDTarlSAF--FSeRVVLKVARVLQVERHPNADMLFVETLDDGSGvERVIVSGLVPYMAADALRGAHVLIVDNLQPRS 714
gi 15789599  587 --------ISFeeFQ-ALDLRVGEVVEAEGIEGADDLARLEVDIGHE-VRQIVAGIKQLHDLDALPGTRVVVVANMEPSE 656
gi 169235311 583 --AEDd--ISFeeFQ-ALDLRVGEVVEAEGIEGADDLARLEVDIGHE-VRQIVAGIKQLHDLDALPGTRVVVVANMEPSE 656
gi 292654972 634 --ADDr--ISFeeFQ-ELDIRVGEIVAAEGIDGADKLAKLTVDIGVE-ERQIVAGIKQLHDLDSLAGSKVVIVANLEKAG 707
gi 222478882 604 iePLSddrISFddFQ-ELDIRIGRIEEAEGIEGADDLLKLRVDLGAE-TRTIVAGLKQLHDVDDLPGTKVVVLANMEKAE 681
gi 289582256 612 --EER---IGFedFQ-ELDIRVGRIESAEGIEGADDLAKLEVDIGFE-TRQVVAGIKQLHDLDELPGEKCILLANMEPAE 684
gi 76801248  592 --ADEr--ISFgdFQ-DLDIRVAEVLEAEPIEGADDLAKLAVDIGVE-TRQIVAGIKQLHDLDSLSGTRIVVVANLEKAE 665
gi 284164098 598 laDER---IGFedFQ-DLDIRVGRIESAEGIEGADDLARLEVDIGFE-TRQVVAGIKQLHDLEELPGEKCILLANMEKAE 672
gi 257053975 591 ----AadrIGFddFQ-ELDIRVGKIVDAEPIKDSDDLVRLDVDIGLE-TRQVVAGIKQLHDVETLPGTRVVLLANMEKAE 664
gi 300711986 590 --------IGFeeFQ-ELDIRVGEIELAEGIEGADDLARLEVDIGVE-TRQIVAGIKRLHDLEELPGTRVVILANLEPAE 659
                        810       820       830       840
                 ....*....|....*....|....*....|....*....|
gi 189026023 715 LRGVrSCGMLLAAEyvdaQGTKAIELVQA-PWALPGERAT 753
gi 15789599  657 LFGVeSNGMVLAAG-------EDADLLTThEDSEPGTKVM 689
gi 169235311 657 LFGVeSNGMVLAAG-------EDADLLTThEDSEPGTKVM 689
gi 292654972 708 LFGVeSNGMLLAAG-------DEADILTThGDAVPGTKVQ 740
gi 222478882 682 LFGVeSNGMVLAAG----EEADLLTTY---EDAGPGTKVK 714
gi 289582256 685 LFGVeSNGMILAAG-------DEADLLTThDDAVVGEKVQ 717
gi 76801248  666 LFGVeSNGMLLAAG----EQADLLTTL---EDAEPGTKVQ 698
gi 284164098 673 LFGVeSNGMILAAG-------EEADLLTThGDAEVGEKVR 705
gi 257053975 665 LFGYeSNGMVLAAS-------EEADLLTThEDAPLGSKIK 697
gi 300711986 660 LFGVeSNGMVLAAG----EDADLLTTL---GDSDPGTKVR 692
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap