Conserved Protein Domain Family
ipk

?
PRK00128: ipk 
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase; Provisional
Links
?
Statistics
?
PSSM-Id: 234652
View PSSM: PRK00128
Aligned: 137 rows
Threshold Bit Score: 382.203
Threshold Setting Gi: 147676431
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
302384956   3 RHLGLKAYGKVNLGLDVLRKREDGYHEVRMIMQTVGLYDKIDIYLKETPGIEVVTNLYYLPVNENNLVYKAARLLMDEFH 82 
167039258   2 KKIKVKAYAKINLSLDVLGKRKDGYHEISTVMQSIDLADILEFEKS--EIVKVFCSGHRVPEGEDNLIVKVINFLKEKYQ 79 
167036607   2 KKIKVKAYAKINLSLDVLGKREDGYHEISTIMQSIDLADILEFEKS--EIVKVFCNDHRVPLGEDNLIVKVINLLKEKYQ 79 
297545514   2 KKIKVKAYAKINLSLDVLGKRKDGYHEISTVMQSIDLADILEFEKS--EIVKVFCSGHRVPEGEDNLIVKVINFLKEKYQ 79 
289579373   2 KKIKVKAYAKINLSLDVLGKRKDGYHEISTVMQSIDLADILEFEKS--EIVKVFCSGHRVPEGEDNLIVKVINFLKEKYQ 79 
304315721   2 NKLRAKSYAKINLSLDVKGKRDDGYHIVNMVLQSIDLCDKLEFE--INSDIVFECDNKYIPSDGSNLIVKAANLLKREFG 79 
83588945    2 DVLTLPAYGKINLTLKVLGRRSDGYHNLSTIFQSIALADRLTFSRC-REGIRLETSGLPVPQGPENLAYRAAARLQSRYG 80 
158319337   2 KQIYLKSRAKINLSLDVRRKREDGYHEVEMIMQQIDLYDNILIRERMDSEIVLSTNCIFIPTTSSNIAYKAAHKLKQRLD 81 
150392285   2 KQVQLKSRAKINLSLDVLGRRSDGYHEVEMIMQQIDLYDLITLEERKDSEIRISTQCEFIPTNEDNIAYRAAEIIRENSG 81 
20808908    1 MKLRIKAYAKVNLTLDVLSKREDGYHEILSVMQSIDLADVIEFEKA--KEILFECDHERVPKGEENLIMKAFNAIRDRYF 78 
302384956  83 VLHGVRIHLNKFIPVSAGMAGGSSDAAAVLFGVNKMFQLGLTREELMERGVKIGADVPYCLMRGTALSEGIGEILTPLPD 162
167039258  80 IEEGVLVRLDKKIPLAAGLAGGSADAAATIVALDKLWNLNMSADEKKEIALKVGADVPFCLEGGTKLAKGIGEIFEDLNV 159
167036607  80 MEEGVLVKLDKRIPLAAGLAGGSADAAATIVALDKLWNLNMSKEEKKEIALKVGADVPFCLEGGTKLAKGIGEIFEDLKI 159
297545514  80 IEEGVLVRLDKKIPLAAGLAGGSADAAATIVALDKLWNLNMSADEKKEIALKVGADVPFCLEGGTKLAKGIGEIFEDLNV 159
289579373  80 IEEGVLVRLDKKIPLAAGLAGGSADAAATIVALDKLWNLNMSADEKKEIALKVGADVPFCLEGGTKLAKGIGEIFEDLNV 159
304315721  80 -GYGALIRLNKNIPAAAGLAGGSSNAAATLVALNKLWDLNIDLPMLKQLAVSLGADVPFCIEGGTKVASGIGDVLLDIKT 158
83588945   81 FP-GVRITLKKQIPLAAGLAGGSADAAATLIGVNALFNLGLTPGQLAREGAALGSDVPFCVIGGTALGRGRGEELSLLPP 159
158319337  82 ITRGIDIFIDKQIPVSAGLAGGSSNAAAVLMGLNHLWSLGLSTKELMEIGVTIGADVPFCLLGGTALAEGIGEVLTPINS 161
150392285  82 INRGVNIYIDKRIPVAAGLAGGSSNAAAVLEGLNHMWRLRLTPKQLMDLGVKLGADVPFCILGGAAIARGIGEILTPIEG 161
20808908   79 LNEGIKIKLFKNIPLAAGLAGGSADAAATIVALDKLWNLNLTEKEMEEIASEVGSDVPFCLKGGTKLASGRGEKLQDLEG 158
302384956 163 MP-QCQILIAKPGISVSTKFVYEHLD----LSvlRKeDHPDIDGMIQAIGNHNIYQVSERLGNVLETVTIPEYPVIARIK 237
167039258 160 P--HMNLLLVKPDIEIFTKKIYDKWD----RL--NFkSHHATCSVVQAIQEGNIYKIAENIKNDLELVTSRECEVINQIK 231
167036607 160 T--SMNLLLVKPDIEISTKEIYDKWD----RL--NFkSHHATVPVVQAIQEGNIYKIAENIKNDLELVTSQKYGIINKIK 231
297545514 160 P--HMNLLLVKPDIEIFTKKIYDKWD----RL--NFkSHHATCSVVQAIQEGNIYKIAENIKNDLELVTSRECEVINQIK 231
289579373 160 P--HMNLLLVKPDIEIFTKKIYDKWD----RL--NFkSHHATCSVVQAIQEGNIYKIAENIKNDLELVTSRECEVINQIK 231
304315721 159 P--QLKLLIVKPPLFVSTKDVYTEYD----KL--DFiENNYTIKMIDAINSGSIVDICSSLGNDLERVTIKNYPIIGEIK 230
83588945  160 LP-TLWLVLVKPSFGVSTAAVYRGWDaspgQT--PM-EAPDEERALAAIRRGDRAGIMASLGNDLEAVTCRLYPEVMAIK 235
158319337 162 DIkNTWIVLVKPAISVSTGDVYGSLD----LS--KIvDRPPTAQLLEAIKEGNIYDVSSKMCNVLETVTVNKYPIITEIK 235
150392285 162 LK-NVWMVIAKPAISVSTAEVYRQLD----LS--KLdSRPNTDEVIQAVKEGDLYTLAGKMHNVLESVTQRNHPIIREMK 234
20808908  159 IP--LNLLLVKPDLEISTKEVYTEWD----NS--GFkSLNSTFLFVEALKKGDLLEIARNISNDLERVTSQKYRVIEDIK 230
302384956 238 DKIKELGAVNAMMSGSGPTVFGIFTSPRAAQQAYEELRygeAknLAKQVYLTNFY 292
167039258 232 EELLKKGALGCAMSGSGPTVYGIFDDLQKLIKAYKNLE---G--IYSFVFFSKTI 281
167036607 232 EELLKKGALGCAMSGSGPTVYGIFDDLEKLRKAYEDLK---E--VYSFVFFSKTI 281
297545514 232 EELLKKGALGCAMSGSGPTVYGIFDDLQKLIKAYKDLE---G--IYSFVFFSKTI 281
289579373 232 EELLKKGALGCAMSGSGPTVYGIFDDLQKLIKAYKDLE---G--IYSFVFFSKTI 281
304315721 231 KMMIERGASGTLMSGSGPTVFGIFDNWDSLNMAYNAFL---N--EGFFVYIANTI 280
83588945  236 MRLLAEGAERAVMCGSGPAVFGVAADGETARRIASRLQ---E--TYPETIVTRTL 285
158319337 236 KKMMEYNALGAMMSGSGPTVFGIFKSYERAKSAYEHLS---L--FYKQSYMVQTY 285
150392285 235 RKMLEYNAIGAMMSGSGPTVFGIYKNYGRAKSAYENLS---I--LYKQTHLVQSY 284
20808908  231 KSLIEKGALSASMTGSGPTVYGVFNDVEKLVRAYHDLK---G--VYPFVAISKTI 280
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap