Conserved Protein Domain Family
era

?
PRK00089: era 
GTPase Era; Reviewed
Links
?
Statistics
?
PSSM-Id: 234624
View PSSM: PRK00089
Aligned: 855 rows
Threshold Bit Score: 286.173
Threshold Setting Gi: 203288092
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 219683898  18 PYRSGFVAVVGRPNVGKSTLINALIGMQIAIASSRPETTRKAIRGVLTTDnAQIVLVDTPGI----HRPRTLLGQRLNDV 93
gi 46200176    4 KTYSGFVAIVGKPNVGKSTLLNNLLGVKVAPISPRPQTTRKRLRGILTegrRQIVFVDTPGL----HKPMDALGEFMDQE 79
gi 55980089    4 KTYSGFVAIVGKPNVGKSTLLNNLLGVKVAPISPRPQTTRKRLRGILTEGrrQIVFVDTPGL----HKPMDALGEFMDQE 79
gi 239909250   4 VSRFGHVVMLGPTNAGKSTLLNRLIGQKISIVSPKPQTTRNSISGIITQGdLQAVFLDTPGL----HRQKRGIAPLLLRS 79
gi 226356852  12 TTHSGFVAIVGKPNVGKSTLLNSFLGTKVAPTSPRPQTTRRGVRGISTTDthQIVFVDTPGL----HKPKDALGKYMNHE 87
gi 94985925   14 PTHAGFVAIVGKPNVGKSTLLNAFLNTKVAPTSPRPQTTRRGVRGIYStdtQQIVFVDTPGL----HKPKDALGKYMNQE 89
gi 15805673   14 TTHAGFVAIVGKPNVGKSTLLNAFLGTKVAPTSPRPQTTRRGVRGIYTLDnrQLIFVDTPGL----HKPKDALGKYMNSE 89
gi 94987086   15 TYRCGWVALIGPPNAGKSTLTNTFVGQKVAIVTSKPQTTRNKIGGILTQDdMQVIFLDTPGIcsekNHVQGQLGKLMLQS 94
gi 297565483   5 TTYSGFVAIVGKPNVGKSTLLNALLGVKVAPISPKPQTTRKRIRGIYSegnRQIVFVDTPGV----HEPEDALGDYMSQQ 80
gi 291296458  14 TTYSGFVAVVGKPNVGKSTLVNTMLGVKIAPISPKPQTTRKRVRGIHTegnRQIVFVDTPGW----HEASDALSEYMIRQ 89
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 219683898  94 VDESLADSDEIAFLLPADQ------EIGPGDRRILSRLR-SqfaTKnddgtfkwkvPLIAIVTKIDRL-N---------R 156
gi 46200176   80 VYEALADVNAVVWVVDLRHpp------tPEDELVARALKpLvgkV-----------PILLVGNKLDAAkY---------P 133
gi 55980089   80 VYEALADVNAVVWVVDLRHpp------tPEDELVARALKpLvgkV-----------PILLVGNKLDAAkY---------P 133
gi 239909250  80 AYAALGQADVVLLILDAAQyarrldGLAPDLRPIVKAVG-Dg--RL----------PVLIALNKADVVrE---------K 137
gi 226356852  88 VHSALADVDVIIWVVDLRHpp------tDEDELVARQVR-El--PK----------PLFLVGNKTDAA-KypdeamklyR 147
gi 94985925   90 VQSALADVDAILWVVDLRHpp------tEEDELVARQVRdLp-------------kPLFLIGNKVDAAkY---------P 141
gi 15805673   90 VHSALSDVDAVVWVVDLRHpp------tDEDRLVANSVR-Dl--PK----------PLFLVGNKTDAAkY---------P 141
gi 94987086   95 AWQGLAIADSIVCVLDGGLylkkpdLMDRDIEPFVEVLR-Qe--VR----------PIVIVVNKIDVFhD---------K 152
gi 297565483  81 VAEALADVNAVVWVVDLRHpp------tREDELVARMLQpi-qnV-----------PILLVGNKLDAAkR---------P 133
gi 291296458  90 ITEALAEVNLVLWLVDLRHpp------tHEDELVARALRpMkdqV-----------PIILVGNKADAArY---------P 143
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 219683898 157 TELVNkliEINEFa-----DFADIVP------VSALGD-DNLQEVRTVLIEHLPEGPQMYPTD-QVTEERPEDAIAELVR 223
gi 46200176  134 EEAMK---AYHELlp-----eAEPRM------LSALDE-RQVAELKADLLALMPEGPFFYPEDyAKSDQTFGEWVAEILR 198
gi 55980089  134 EEAMK--------------AYHELLPeaeprmLSALDE-RQVAELKADLLALMPEGPFFYPEDyAKSDQTFGEWVAEILR 198
gi 239909250 138 ARLLP---VLAAVse--alPAAELFP------ISALTG-LGVDDLLTALMSRLPEGAHQFDPD-EVSTAPVRFLAAEIVR 204
gi 226356852 148 AQLEGrs-----------aETSEIM-------LSAQNNpLQVATLREQILDILPENPFFYPRG-AASDQSRETWAAEIIR 208
gi 94985925  142 DEAMR---LYRALlegrtgE-THERM------LSAQNSpQAVAALREQILDALPENPFFFPRS-SASDQTREQWAAEIIR 210
gi 15805673  142 EEAMK---LYGALlegrgsd-----lpvsetmLSAQNSvNAVATLREQLLEVLPENPFFFPQG-AASDQSREMWAAEIIR 212
gi 94987086  153 SRMLP---MLAKLge--yfPTAEIFP------ISARYK-NGTDKLLDTICLKLPEGEAIFPED-QLSTVPVRFMVAEIIR 219
gi 297565483 134 EDAMQ---EYRSLlh-----qAEPRM------LSALDE-RAVKNLRDELLAMLPEGPFFYPEVfSRSDQSPEEWSAEIVR 198
gi 291296458 144 EAALQ---AYAELlp-----gLETRM------ISAQNE-RDAKALRDEILSLLPEGPFFFPEDyAKGDQTPEEWAAEIVR 208
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 219683898 224 GVLLEELDDELPHSLAVVVDSIDM--PedmdeddaqamhGKARVMVSIYVERDSQKPIIIGRHAEHLVRIKKRLRTPVNR 301
gi 46200176  199 EEAMKRLWHEVPYAVATKVEEVAE--Re----------nGVLYIKAILYVERPSQKAIVIGEGGRKIKEIGQATRKQLEA 266
gi 55980089  199 EEAMKRLWHEVPYAVATKVEEVAE--Re----------nGVLYIKAILYVERPSQKAIVIGEGGRKIKEIGQATRKQLEA 266
gi 239909250 205 EKLFLALGEELPYSTAVTIEDWDE--Rsk---------pGLTKIRAAIHVARESHKPMVIGKGGERLKDVGQKARADIEE 273
gi 226356852 209 EEAMKKLREELPYAVATRVNRWTEr-Ed-----------GLQRIEGEIVVEKNAHKGMVIGSGGKQLREIGQAARKQLEV 276
gi 94985925  211 EEAMKRLREELPYAVATRVTNWTE--Re----------dGLQRIEAELIVEKNAHKGMVIGAGGKMLREIGQAARKQLEV 278
gi 15805673  213 EEAMKKLRDELPYAVATRVNRWTEreDg------------LQRIEGEIIVEKNAHKGMVIGAGGKQLREIGQAARKQLEV 280
gi 94987086  220 EKLFEQLYQEVPYAVAVEVEKWDE--Esr---------kNQVVIYAVIYVARASHKAMVIGQAGERIKSIGTMARKEIKA 288
gi 297565483 199 EEAMKRLREEIPYAIATKTEEFTE--Re----------kGKLYIRTVLYVERDSHKPILIGKGGRMLKEIGQAARKQLEV 266
gi 291296458 209 EEAMKRLKEEIPYSIATKTEAFEL--Rpapa----ggggGTFYIQVNIYVERENHKPILIGAGGRKLKEIGAAARKQLEV 282
                        330       340       350
                 ....*....|....*....|....*....|
gi 219683898 302 LVGRKANLDLHVKVAKNWQSDPKKLDRLGF 331
gi 46200176  267 LLGKKVYLDLEVKVYPDWRKDPEALRELGY 296
gi 55980089  267 LLGKKVYLDLEVKVYPDWRKDPEALRELGY 296
gi 239909250 274 MLGGQVFLELWVKVRPDWTDDRAFLRDLGL 303
gi 226356852 277 FLDRKVFLGLEVIVIPGWREDEEALRELGY 306
gi 94985925  279 FLNCKVFLGLEVIVIPGWREDEEALRELGY 308
gi 15805673  281 FLNHKVYLGLEVIVIPGWREDEEALRELGY 310
gi 94987086  289 LLGKKVHLELWVKVRESWINDNQFLYELGF 318
gi 297565483 267 FLSRPVYLELEVKVYPGWRKDPEALRELGY 296
gi 291296458 283 FLARKVYLDLQVKVYPNWRKDPEALRELGY 312
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap