Conserved Protein Domain Family
PLN03193

?
PLN03193: PLN03193 
beta-1,3-galactosyltransferase; Provisional
Statistics
?
PSSM-Id: 178735
Aligned: 11 rows
Threshold Bit Score: -1
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15225684    1 MSTKIKGElFPSRSLVSKKWTFLLCFGSFCFGILFTDRMWIIPESKDMPRPSVsTEAERLKLISEGCDPKTLY---QKEV 77 
145323746   1 MSAKIKGE-YSSRSFVSRKWTILLCLGSFCVGMFFTNRMWNIPESKGMSHPSV-TEAERLKLVSEGCNPKALY---QKEV 75 
15220440    1 MSAKIKGE-YSSRSFVSRKWTILLCLGSFCVGMFFTNRMWNIPESKGMSHPSV-TEAERLKLVSEGCNPKA------KEV 72 
255566417   1 -------------------------------MRKIADRMWTVPESKSITRTTA-MEAEKLKLVSEGCGIET------KEV 42 
225447013   1 MSLKSRGE-LPSRSVISQKWTLLLCVGCFCAGMFFTNRMWAVPESKGITRTTA-VEAEKLKLVSEGCDPKTLQ---QKFV 75 
225460949   1 MSWKSRGIePSSKSVVSRKWTLLFCIGCFCAGMLFSDRMWTMPEAKGISRTTR-TEDEELKLVSEGCAPTTVSisvQKDV 79 
225460951   1 MSWKSRGIePSSKSVVSRKWTLLFCIGCFCAGMLFSDRMWTMPEAKGISRTTR-TEDEELKLVSEGCAPTT------KDV 73 
224128958   1 MSFKSRGDqQSSKNVISKKWALFFCLACFCAGVFFNNRMWTVPEPKGITRTTT-MEAESLKLVSEGCGDEI------KEV 73 
224069002   1 MNFKSRGDqQSYKNAISQKWTLFLCLACFCSGMLLANWTWNVPEPKGINRTTT-VEAEKLKLVSEGCGDEI------KEV 73 
297848780   1 MSTKNKVE-YTSRSFVSRKWTILLCLGSFCVGMFFTDRMWNIPESKGMSRPSV-TEAERLKLISEGCNPKTLY---QKEV 75 
297823011   1 MSTKIKGElFSSRSLVSKKWTFLLCFGSFCFGILFTDRMWIIPESKDMSRPSVsTEAERLKLISEGCDPKNLY---QKEV 77 
145323746   1 MSAKIKGE-YSSRSFVSRKWTILLCLGSFCVGMFFTNRMWNIPESKGMSHPSV-TEAERLKLVSEGCNPKALY---QKEV 75 
15220440    1 MSAKIKGE-YSSRSFVSRKWTILLCLGSFCVGMFFTNRMWNIPESKGMSHPSV-TEAERLKLVSEGCNPKA------KEV 72 
255566417   1 -------------------------------MRKIADRMWTVPESKSITRTTA-MEAEKLKLVSEGCGIET------KEV 42 
225447013   1 MSLKSRGE-LPSRSVISQKWTLLLCVGCFCAGMFFTNRMWAVPESKGITRTTA-VEAEKLKLVSEGCDPKTLQ---QKFV 75 
225460949   1 MSWKSRGIePSSKSVVSRKWTLLFCIGCFCAGMLFSDRMWTMPEAKGISRTTR-TEDEELKLVSEGCAPTTVSisvQKDV 79 
225460951   1 MSWKSRGIePSSKSVVSRKWTLLFCIGCFCAGMLFSDRMWTMPEAKGISRTTR-TEDEELKLVSEGCAPTT------KDV 73 
224128958   1 MSFKSRGDqQSSKNVISKKWALFFCLACFCAGVFFNNRMWTVPEPKGITRTTT-MEAESLKLVSEGCGDEI------KEV 73 
224069002   1 MNFKSRGDqQSYKNAISQKWTLFLCLACFCSGMLLANWTWNVPEPKGINRTTT-VEAEKLKLVSEGCGDEI------KEV 73 
297848780   1 MSTKNKVE-YTSRSFVSRKWTILLCLGSFCVGMFFTDRMWNIPESKGMSRPSV-TEAERLKLISEGCNPKTLY---QKEV 75 
297823011   1 MSTKIKGElFSSRSLVSKKWTFLLCFGSFCFGILFTDRMWIIPESKDMSRPSVsTEAERLKLISEGCDPKNLY---QKEV 77 
15225684   78 NRDPQALFGEVSKTHNAIQTLDKTISSLEMELAAARSAQESLVNGAPISNDMEKKQLPGKRRYLMVVGINTAFSSRKRRD 157
145323746  76 KRDPQALFGEVANTHIALQTLDKTISSLEMELAAARSVQESLQNGAPLSDDMGKKQPQEQRRFLMVVGINTAFSSRKRRD 155
15220440   73 KRDPQALFGEVANTHIALQTLDKTISSLEMELAAARSVQESLQNGAPLSDDMGKKQPQEQRRFLMVVGINTAFSSRKRRD 152
255566417  43 RRDSKDIIGEVYKTHNAIQTLDKTISNLEMELAAARAAQESILSGSPLSEDLKSTGSSGKRRYLMVVGINTAFSSRKRRD 122
225447013  76 KRDSKDIIGEVHKTHHAIQTLDKTISNLEMELAAARAAQESMVNGSPISEDLQKTESSGRKRYLMVVGINTAFSSRKRRD 155
225460949  80 KHKSKDILGEVSRTHYAIQTLDKTISNLEMELAAARAAQESILNGSPITEDLPITKSSGRRKYLMVIGINTAFSSRKRRD 159
225460951  74 KHKSKDILGEVSRTHYAIQTLDKTISNLEMELAAARAAQESILNGSPITEDLPITKSSGRRKYLMVIGINTAFSSRKRRD 153
224128958  74 KRDSKDIIGEVYKTHNAIQTLDKTISNLEMELAAARAAQESILSGSPLSEDLKRTGSSGKRRYLMVVGINTAFSSRKRRD 153
224069002  74 KRDSKDIIGEVYKTHNAIQTLDKTISNLEMELAAARAAQESILSGSPLSDDLKRTGSSGKRRYLMVIGINTAFSSRKRRD 153
297848780  76 KRDPQALFGEVANTHIALQTLDKTISSLEMELAAARSVQESLQNGAPVSDDMGKKQPQGKRRFLMVVGINTAFSSRKRRD 155
297823011  78 NRDPQALLGEVSKTHNAIQTLDKTISSLEMELAAARSAQESLINGAPISNDVEKRQLPGKRRYLMVVGINTAFSSRKRRD 157
145323746  76 KRDPQALFGEVANTHIALQTLDKTISSLEMELAAARSVQESLQNGAPLSDDMGKKQPQEQRRFLMVVGINTAFSSRKRRD 155
15220440   73 KRDPQALFGEVANTHIALQTLDKTISSLEMELAAARSVQESLQNGAPLSDDMGKKQPQEQRRFLMVVGINTAFSSRKRRD 152
255566417  43 RRDSKDIIGEVYKTHNAIQTLDKTISNLEMELAAARAAQESILSGSPLSEDLKSTGSSGKRRYLMVVGINTAFSSRKRRD 122
225447013  76 KRDSKDIIGEVHKTHHAIQTLDKTISNLEMELAAARAAQESMVNGSPISEDLQKTESSGRKRYLMVVGINTAFSSRKRRD 155
225460949  80 KHKSKDILGEVSRTHYAIQTLDKTISNLEMELAAARAAQESILNGSPITEDLPITKSSGRRKYLMVIGINTAFSSRKRRD 159
225460951  74 KHKSKDILGEVSRTHYAIQTLDKTISNLEMELAAARAAQESILNGSPITEDLPITKSSGRRKYLMVIGINTAFSSRKRRD 153
224128958  74 KRDSKDIIGEVYKTHNAIQTLDKTISNLEMELAAARAAQESILSGSPLSEDLKRTGSSGKRRYLMVVGINTAFSSRKRRD 153
224069002  74 KRDSKDIIGEVYKTHNAIQTLDKTISNLEMELAAARAAQESILSGSPLSDDLKRTGSSGKRRYLMVIGINTAFSSRKRRD 153
297848780  76 KRDPQALFGEVANTHIALQTLDKTISSLEMELAAARSVQESLQNGAPVSDDMGKKQPQGKRRFLMVVGINTAFSSRKRRD 155
297823011  78 NRDPQALLGEVSKTHNAIQTLDKTISSLEMELAAARSAQESLINGAPISNDVEKRQLPGKRRYLMVVGINTAFSSRKRRD 157
15225684  158 SVRTTWMPSGEKRKKLEEEKGIIIRFVIGHSATAGGILDRSIEAEDKKHGDFLRLDHVEGYLELSGKTKTYFSTAVSKWD 237
145323746 156 SIRATWMPQGEKRKRLEEEKGIIIRFVIGHSATTGGILDRAIEAEDRKHGDFLRLDHVEGYLELSGKTKTYFSTAFSMWD 235
15220440  153 SIRATWMPQGEKRKRLEEEKGIIIRFVIGHSATTGGILDRAIEAEDRKHGDFLRLDHVEGYLELSGKTKTYFSTAFSMWD 232
255566417 123 SVRATWMPQGEKRKKLEEEKGIIIRFVIGHSATSGGILDRAIEAEDKKHGDFLRLDHVEGYLELSAKTKIYFATAVALWD 202
225447013 156 SVRATWMPQGEKRKKLEEEKGIIIRFVIGHSATSGGILDRAIEAEDKKHGDFLRLEHVEGYLELSAKTKIYFATAVALWD 235
225460949 160 SVRATWMPQGDKRKKLEEEKGIIVRFVIGHSATSGGILDRAIEAEDRRHGDFLRLEHVEGYLELSAKTKAYFATAVAMWD 239
225460951 154 SVRATWMPQGDKRKKLEEEKGIIVRFVIGHSATSGGILDRAIEAEDRRHGDFLRLEHVEGYLELSAKTKAYFATAVAMWD 233
224128958 154 SVRATWFPQGEKRKKLEDEKGIIVRFVIGHSATSGGILDRAIEAEDRKHGDFLRLDHVEGYLELSAKTKIYFATAVALWD 233
224069002 154 SVRATWMPQGEKRKKLEEEKGIIVRFVIGHSATSGGILDRAIEAEDKKHGDFLRLDHVEGYLELSAKTKIYFATAVTLWD 233
297848780 156 SIRATWMPQGEKRKRLEEEKGIIIRFVIGHSATTGGILDRAIEAEDRKHGDFLRLDHVEGYLELSGKTKTYFSTAFSMWD 235
297823011 158 SVRTTWMPSGEKRKKLEEEKGIIIRFVIGHSATAGGILDRSIEAEDKKHGDFLRLDHVEGYLELSGKTKTYFSTAVSKWD 237
145323746 156 SIRATWMPQGEKRKRLEEEKGIIIRFVIGHSATTGGILDRAIEAEDRKHGDFLRLDHVEGYLELSGKTKTYFSTAFSMWD 235
15220440  153 SIRATWMPQGEKRKRLEEEKGIIIRFVIGHSATTGGILDRAIEAEDRKHGDFLRLDHVEGYLELSGKTKTYFSTAFSMWD 232
255566417 123 SVRATWMPQGEKRKKLEEEKGIIIRFVIGHSATSGGILDRAIEAEDKKHGDFLRLDHVEGYLELSAKTKIYFATAVALWD 202
225447013 156 SVRATWMPQGEKRKKLEEEKGIIIRFVIGHSATSGGILDRAIEAEDKKHGDFLRLEHVEGYLELSAKTKIYFATAVALWD 235
225460949 160 SVRATWMPQGDKRKKLEEEKGIIVRFVIGHSATSGGILDRAIEAEDRRHGDFLRLEHVEGYLELSAKTKAYFATAVAMWD 239
225460951 154 SVRATWMPQGDKRKKLEEEKGIIVRFVIGHSATSGGILDRAIEAEDRRHGDFLRLEHVEGYLELSAKTKAYFATAVAMWD 233
224128958 154 SVRATWFPQGEKRKKLEDEKGIIVRFVIGHSATSGGILDRAIEAEDRKHGDFLRLDHVEGYLELSAKTKIYFATAVALWD 233
224069002 154 SVRATWMPQGEKRKKLEEEKGIIVRFVIGHSATSGGILDRAIEAEDKKHGDFLRLDHVEGYLELSAKTKIYFATAVTLWD 233
297848780 156 SIRATWMPQGEKRKRLEEEKGIIIRFVIGHSATTGGILDRAIEAEDRKHGDFLRLDHVEGYLELSGKTKTYFSTAFSMWD 235
297823011 158 SVRTTWMPSGEKRKKLEEEKGIIIRFVIGHSATAGGILDRSIEAEDKKHGDFLRLDHVEGYLELSGKTKTYFSTAVSKWD 237
15225684  238 AEFYVKVDDDVHVNIATLGETLVRHRKKHRVYLGCMKSGPVLSQKGVRYHEPEYWKFGENGNKYFRHATGQLYAISRDLA 317
145323746 236 ADFYVKVDDDVHVNIATLGETLVRHRKKPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGENGNKYFRHATGQLYAISRDLA 315
15220440  233 ADFYVKVDDDVHVNIATLGETLVRHRKKPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGENGNKYFRHATGQLYAISRDLA 312
255566417 203 ADFYVKVDDDVHVNIATLGETLVRHRKKSRLYIGCMKSGPVLNQKGVRYHEPEFWKFGEAGNKYFRHATGQLYAISKDLA 282
225447013 236 AEFYIKVDDDVHVNIATLGETLVRHRKKPRVYIGCMKSGPVLAQKGVRYHEPEYWKFGEAGNKYFRHATGQLYAISKDLA 315
225460949 240 ADFYVKVDDDVHVNIATLGATLARHRSKPRIYIGCMKSGPVLAQKXXXXXXXEYWKFGEEGNKYFRHATGQLYAISKDLA 319
225460951 234 ADFYVKVDDDVHVNIATLGATLARHRSKPRIYIGCMKSGPVLAQKXXXXXXXEYWKFGEEGNKYFRHATGQLYAISKDLA 313
224128958 234 ADFYVKVDDDVHVNIATLGETLVRHRKKPRVYIGCMKSGPVLNQKGVRYHEPEYWKFGEAGNKYFRHATGQLYAISKDLA 313
224069002 234 ADFYVKVDDDVHVNIATLGETLVRHRKKPRVYIGCMKSGPVLNQKGVRYHEPEYWKFGEAGNKYFRHATGQLYAISKDLA 313
297848780 236 ADFYVKVDDDVHVNIATLGETLVRHRKKPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGENGNKYFRHATGQLYAISRDLA 315
297823011 238 AEFYVKVDDDVHVNIATLGETLVRHRKKHRVYIGCMKSGPVLSQKGVRYHEPEYWKFGENGNKYFRHATGQLYAISRDLA 317
145323746 236 ADFYVKVDDDVHVNIATLGETLVRHRKKPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGENGNKYFRHATGQLYAISRDLA 315
15220440  233 ADFYVKVDDDVHVNIATLGETLVRHRKKPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGENGNKYFRHATGQLYAISRDLA 312
255566417 203 ADFYVKVDDDVHVNIATLGETLVRHRKKSRLYIGCMKSGPVLNQKGVRYHEPEFWKFGEAGNKYFRHATGQLYAISKDLA 282
225447013 236 AEFYIKVDDDVHVNIATLGETLVRHRKKPRVYIGCMKSGPVLAQKGVRYHEPEYWKFGEAGNKYFRHATGQLYAISKDLA 315
225460949 240 ADFYVKVDDDVHVNIATLGATLARHRSKPRIYIGCMKSGPVLAQKXXXXXXXEYWKFGEEGNKYFRHATGQLYAISKDLA 319
225460951 234 ADFYVKVDDDVHVNIATLGATLARHRSKPRIYIGCMKSGPVLAQKXXXXXXXEYWKFGEEGNKYFRHATGQLYAISKDLA 313
224128958 234 ADFYVKVDDDVHVNIATLGETLVRHRKKPRVYIGCMKSGPVLNQKGVRYHEPEYWKFGEAGNKYFRHATGQLYAISKDLA 313
224069002 234 ADFYVKVDDDVHVNIATLGETLVRHRKKPRVYIGCMKSGPVLNQKGVRYHEPEYWKFGEAGNKYFRHATGQLYAISKDLA 313
297848780 236 ADFYVKVDDDVHVNIATLGETLVRHRKKPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGENGNKYFRHATGQLYAISRDLA 315
297823011 238 AEFYVKVDDDVHVNIATLGETLVRHRKKHRVYIGCMKSGPVLSQKGVRYHEPEYWKFGENGNKYFRHATGQLYAISRDLA 317
15225684  318 SYISLNQHVLHKYANEDVTLGAWFIGLDVTHIDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRSADRIKEVHKRC 397
145323746 316 SYISINQHVLHKYANEDVSLGAWFIGIDVKHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICRSADRIKEVHRRC 395
15220440  313 SYISINQHVLHKYANEDVSLGAWFIGIDVKHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICRSADRIKEVHRRC 392
255566417 283 TYISINQHVLHKYANEDVSLGSWFIGLDVEHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICRSADRIKEVHRRC 362
225447013 316 RYISINQHVLHKYANEDVSLGSWFIGLDAEHIDDRRLCCGTPPDCEWKAQAGNACVASFDWSCSGICRSSERIKEVHRRC 395
225460949 320 TYISINQHVLHKYANEDVSLGSWFIGLDAEHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICRSSERIREVHRRC 399
225460951 314 TYISINQHVLHKYANEDVSLGSWFIGLDAEHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICRSSERIREVHRRC 393
224128958 314 TYISINQHLLHKYANEDVSLGSWFIGLDVDHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICRSADRIKEVHRRC 393
224069002 314 KYISINQHVLHKFANEDVSLGSWFIGLDAEHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICRSADRIKEVHRRC 393
297848780 316 SYISINQHVLHKYANEDVSLGAWFIGIDVKHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICRSADRIKEVHRRC 395
297823011 318 SYIALNQHVLHKYANEDVTLGAWFIGLDVTHIDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRSADRIKEVHKRC 397
145323746 316 SYISINQHVLHKYANEDVSLGAWFIGIDVKHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICRSADRIKEVHRRC 395
15220440  313 SYISINQHVLHKYANEDVSLGAWFIGIDVKHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICRSADRIKEVHRRC 392
255566417 283 TYISINQHVLHKYANEDVSLGSWFIGLDVEHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICRSADRIKEVHRRC 362
225447013 316 RYISINQHVLHKYANEDVSLGSWFIGLDAEHIDDRRLCCGTPPDCEWKAQAGNACVASFDWSCSGICRSSERIKEVHRRC 395
225460949 320 TYISINQHVLHKYANEDVSLGSWFIGLDAEHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICRSSERIREVHRRC 399
225460951 314 TYISINQHVLHKYANEDVSLGSWFIGLDAEHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICRSSERIREVHRRC 393
224128958 314 TYISINQHLLHKYANEDVSLGSWFIGLDVDHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICRSADRIKEVHRRC 393
224069002 314 KYISINQHVLHKFANEDVSLGSWFIGLDAEHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICRSADRIKEVHRRC 393
297848780 316 SYISINQHVLHKYANEDVSLGAWFIGIDVKHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICRSADRIKEVHRRC 395
297823011 318 SYIALNQHVLHKYANEDVTLGAWFIGLDVTHIDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRSADRIKEVHKRC 397
15225684  398 GEPENAIWKARF 409
145323746 396 GEGEKALWSATF 407
15220440  393 GEGEKALWSATF 404
255566417 363 GEGENALWSATF 374
225447013 396 GEGENALWNAVF 407
225460949 400 GEGENAVWSAVF 411
225460951 394 GEGENAVWSAVF 405
224128958 394 GEGEKALWRATF 405
224069002 394 GEGENALWSATF 405
297848780 396 GEGEKALWSATF 407
297823011 398 GEPENAIWKARF 409
145323746 396 GEGEKALWSATF 407
15220440  393 GEGEKALWSATF 404
255566417 363 GEGENALWSATF 374
225447013 396 GEGENALWNAVF 407
225460949 400 GEGENAVWSAVF 411
225460951 394 GEGENAVWSAVF 405
224128958 394 GEGEKALWRATF 405
224069002 394 GEGENALWSATF 405
297848780 396 GEGEKALWSATF 407
297823011 398 GEPENAIWKARF 409
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap