Conserved Protein Domain Family
PLN02863

?
PLN02863: PLN02863 
UDP-glucoronosyl/UDP-glucosyl transferase family protein
Statistics
?
PSSM-Id: 215465
Aligned: 5 rows
Threshold Bit Score: 874.966
Created: 9-Dec-2010
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
225455736   1 MTALDSGAGAHVLVFPFPSQGHMIPLLDLTHQLATRG---LSITVLVTPQNLSLLNPLLSKHPSIRTLVLPFPPHPSIPA 77 
22330612    4 NEENNKPTKTHVLIFPFPAQGHMIPLLDFTHRLALRGgaaLKITVLVTPKNLPFLSPLLSAVVNIEPLILPFPSHPSIPS 83 
224121446   1 -----MSAGAHVLLFPFPAQGHLIPLLDLAHHLVIRG---LTITILVTPKNLPILNPLLSKNSTINTLVLPFPNYPSIPL 72 
255547075   1 MTILAPEAETHILVFPFPAQGHMIPLLDLTRKLAVHG---LTITILVTPKNLSFLHPLLSTHPSIETLVFPFPAHPLIPS 77 
297839263   4 NEENNKPTKTHVLIFPFPAQGHMIPLLDFTHRLALRGgaaLTITVLVTPKNLPFLSPLLSAVSNIETLILPFPSHPSIPS 83 
225455736  78 GVENSKDLSGKYFGA-MLITLGELYNPIVDWFRTHPSPPVAIISDMFLGWTQQlaceLGIHRVVFSPSGAMSLSAMYSLW 156
22330612   84 GVENVQDLPPSGFPL-MIHALGNLHAPLISWITSHPSPPVAIVSDFFLGWTKN----LGIPRFDFSPSAAITCCILNTLW 158
224121446  73 GIENLKDLPPNIRPTsMIHALGELYQPLLSWFRSHPSPPVAIISDMFLGWTHRlacqLGVRRFVFSPSGAMALATMYSLW 152
255547075  78 GVENNKDLPAECTPV-LIRALGGLYDPLLHWFISHPSPPVAIISDMFLGWTQNlasqLNIRRIVFSPSGAMALSIIYSLW 156
297839263  84 GVENVQDLPPSGFPL-MIHALGNLHAPLLSWITSHPSPPVAIVSDFFLGWTNN----LGIPRFDFSPSAAITCCILNTLW 158
225455736 157 RDLPKIEDPTNLKATICFSKMPNSPVLAWWQVSGLYRRYIERAPFSEFTKDIFRGNIASWGLVINSFTELEGDYLDYLAN 236
22330612  159 IEMPTKINEDDDNEILHFPKIPNCPKYRFDQISSLYRSYVHGDPAWEFIRDSFRDNVASWGLVVNSFTAMEGVYLEHLKR 238
224121446 153 QEMPNA--PKDQNELFSFSKIPSCPKYPWLQISTIYRSYVEGDPVSEFTKEGMEANIASWGLIVNSLTLLEGIYFEHLRK 230
255547075 157 RDMPRR----NQNEVVSFSRIPNCPNYPWRQISPIYRSYIENDTNWEFIKDSFRANLVSWGLVVNSFTELEEIYLDYFKK 232
297839263 159 IEMPTKINEDDDNEILQFPKIPNCPKYPFNQISSLYRSYVHGDPAWEFIRDSFRDNAASWGLVVNSFTAMEGVYLEHLKR 238
225455736 237 ELGHDRVWDVGPLHFLDgek-sgLMDRGGPSSVSADDILTWLDTCGDNKVVYACFGSQAVLNNRQMEGLALGLEKSGARF 315
22330612  239 EMGHDRVWAVGPIIPLS------GDNRGGPTSVSVDHVMSWLDAREDNHVVYVCFGSQVVLTKEQTLALASGLEKSGVHF 312
224121446 231 QLGHDRVWAVGPILPEKtid-mtPPERG----VSMHDLKTWLDTCEDHKVVYVCYGTQVVLTKYQMEAVASGLEKSGVHF 305
255547075 233 ELGSDHVWAVGPLLPPHhdsisrQSERGGPSSVPVHDVMAWLDTCEDHRVVYVCFGSQTWLTKDQIEELALSLEMSKVNF 312
297839263 239 EMGHDCVWAVGPILPLS------DGNRGGPTSVSVDHVMSWLDAREDDHVVYVCFGSQTVLTKEQTLALASGLEKSGVHF 312
225455736 316 IWSIKEPTNEhvEGDHWALPPGFEDRVAgtGRGLIIRGWSPQVMILSHRAVGAFLTHCGWNSILEGLVAGVSMLAWPMAA 395
22330612  313 IWAVKEPVEK--DSTRGNILDGFDDRVA--GRGLVIRGWAPQVAVLRHRAVGAFLTHCGWNSVVEAVVAGVLMLTWPMRA 388
224121446 306 IWCVKQPSKEhvGEGYSMIPSGFEDRVA--GRGLIIRGWAPQVWILSHRAVGAFLTHCGWNSILEGIVAGVPMLACPMAA 383
255547075 313 IWCVKEHING----KYSVIPSGFEDRVA--GRGLVIRGWVPQVLILSHPAVGAFLTHCGWNSVLEGLVAAVPMLAWPMGA 386
297839263 313 IWAVKEPVEG--ESPRGNILDGFDDRVA--GRGLVIRGWAPQVAVLRHRAVGAFLTHCGWNSVIEAVVAGVLMLTWPMRA 388
225455736 396 DQFLNSILLVNELKVAVKVCEGAESVPDSTELARAVTLSVS-ENWAARERVTELRRAAVEAIKPGGSSAKNLDALVKHLS 474
22330612  389 DQYTDASLVVDELKVGVRACEGPDTVPDPDELARVFADSVT-GNQTERIKAVELRKAALDAIQERGSSVNDLDGFIQHVV 467
224121446 384 DQFVGATLLVEDLKVAKRVCDGANLVSNSAKLARTLMESVSdESQVEKERAKELRMAALDAIKEDGSSDKHLNAFVKHVV 463
255547075 387 DQFVNARLLVDELQVAVRVCEGAKTVPNSDELARVIMESVS-ENRVEREQAKKLRRVAMDTIKDRGRSMKDFDGLVKNLF 465
297839263 389 DQYTDASLVVDELKVGVRACEGPDTVPDPDELARVFADSVT-GKQTERIKAVELRKAALDAIQERGSSVKDLDGFIQHVV 467
225455736 475 EFNLQE 480
22330612  468 SLGLNK 473
224121446 464 GLGMET 469
255547075 466 RLKVEA 471
297839263 468 NLRLNN 473
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap