Conserved Protein Domain Family
PLN02849

?
PLN02849: PLN02849 
beta-glucosidase
Statistics
?
PSSM-Id: 215455
Aligned: 5 rows
Threshold Bit Score: 964.433
Created: 9-Dec-2010
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
22328869    1 MELTLSLLTIFLLFFALS---GRCS----DKNDFPEGFIFGSATSAYQWEGAFDEDGRKPSVWDTFLHTRNLSNGDITSD 73 
42571767    1 MEDVLTLITMIVLLLLAFhgfGKCSsdlySRSDFPEGFVFGAGISAYQWEGAVDEDGRKPSVWDTFLHCRKMDNGDIACD 80 
22330338    1 MEQILALFAIFLAFAFS----GKCSdv-fSRSDYPEGFVFGAGTSAYQWEGAAAEDGRKPSLWDTLCHSRDQGNGDIACD 75 
297799820   1 MELILSLFTTFLFLALS----GRCS----DKNDFPEGFTFGSATSAYQWEGAFDEDGRKPSVWDTFLHSRNRSNGDITCD 72 
297846874   1 MEEFLSSITMFMLLLLASsrfGKCSsdvySRSDFPEGFAFGAGISAYQWEGAVKEDGRKPSVWDTFLHSRKMDNGDIACD 80 
22328869   74 GYHKYKEDVKLMVETGLDAFRFSISWSRLIPNGRGPVNPKGLQFYK-----------NFIQELVSHGIEPHVTLFHYDHP 142
42571767   81 GYHKYKEDVQLMAETGLHTFRFSISWSRLISNGRGSINPKGLQFYK-----------NFIQELVKHGIEPHVTLHHYDFP 149
22330338   76 GYHKYKDDVKLMVDTNLDAFRFSISWSRLIPNGRGPVNQKGLQFYK-----------NLIQELVSHGIEPHVTLYHYDHP 144
297799820  73 GYHKYK---------------MCRSWWKLAEMPSDSPFLR-LGLYRvrkvlliprvySSIRTSFKNSIEPHVTLFHYDHP 136
297846874  81 GYHKYKEDVQLMAETGLHAFRFSISWSRLISNGKGSINPKGLQFYK-----------NFIQELVKHGIEPHVTLHHYDHP 149
22328869  143 QYLEDEYGGWINRRIIQDFTAYANVCFREFGHHVKFWTTINEANIFTIGGYNDGITPPGRCSSPGRNCSSGNSSTEPYIV 222
42571767  150 QYLEDDYGGWTNRKIIKDFTAYADVCFREFGNHVKFWTTINEANIFTIGGYNDGNSPPGRCSFPGRNCTLGNSSTETYIV 229
22330338  145 QSLEDEYGGWLNHRMIKDFTTYADVCFREFGNHVKLWTTINEANIFSIGGYNDGDTPPGRCSKPSKNCSSGNSSIEPYIV 224
297799820 137 QYLEDDYGGSINRRIIQDFTAYADVCFREFGHHVKFWTTINEANIFTIGGYNDGITPPGRCSSPGRNCSSGNSSTEPYIV 216
297846874 150 QYLEDDYGGWINRKIIEDFTAYADVCFREFGNHVKFWTTINEANIFSIGGYNDGNSPPGRCSFPGRSCLLGNSSTETYIV 229
22328869  223 GHNLLLAHASASRLYKQKYKDMQGGSVGFSLFSLGFTPSTSSKDDDIAVQRAKDFYFGWMLEPFIFGDYPDEMKRTVGSR 302
42571767  230 GHNLLLAHASVSRLYKQKYKDIQGGSVGFSLFAMNFTPSTNSKDDEIATKRANDFYLGWMLEPLIYGDYPDVMKRTIGSR 309
22330338  225 GHNLLLAHASVSRRYKQKYKDKQGGSIGFSLFILGLIPTTSSKDDATATQRAQDFYVGWFLRPLLFGDYPDTMKRTIGSR 304
297799820 217 GHNLRLAHASASRPYKQKYKDMQGGSIGLSLFALGFTPSTSSKDDDIAIQRAKDFYSGWMLEPLIFGDYPDEMKRIVGSR 296
297846874 230 GHNLLLAHASVSRLYKQKYKDIQGGSIGFSLFSMYFTPSTSSKDDKIATQRANDFYLGWMLEPLIYGDYPDVMRKTIGSR 309
22328869  303 LPVFSKEESEQVKGSSDFIGIIHYLAASVTSIKIKPSISGNPDFYSDMGvsmtwtvlgnfsafeyavapwamesVLEYIK 382
42571767  310 LPVFSKEESEQVKGSSDFIGVIHYLTALVTNIDINPSLSGIPDFNSDMG-------------------------ILEYIK 364
22330338  305 LPVFSEKESEQVKGSCDFVGVIHYHAASVTNIKSKPSLSGNPDFYSYMEtdfgksldfq-----yantpwamevVLEYIK 379
297799820 297 LPVFSKEESEQVKGSSDFVGIIHYLAASVTNIKIRPSISGNPNFYSDMGvsmtwtvlgkfsafeydvapwamesVLEYIK 376
297846874 310 LPVFSEEESEQVKGSSDFIGVIHYVTASVKNIDINPSLSGIPDFNSDMGqsi--------------------nsILEYIK 369
22328869  383 QSYGNPPIYILEN----------GTPMKQDLQLQQKDTPRIEYLHAYIAAVLKSIRNGSDTRGYFIWSFMDLYELVKGYE 452
42571767  365 QSYGNPPVYILEN----------GKTMNQDLELQQKDTPRIEYLDAYIGAVLKAVRNGSDTRGYFVWSFMDLYELLNGYK 434
22330338  380 QSYGNPPVYILESakftfqwqqiGTPMKQDSQLKQKDIPRVEYLHAYIGGVLKSIRNGSDTRGYFVWSFMDLYELLGGYE 459
297799820 377 QSYGNPPIYILEN----------GTPMKQDLQLQQKDTPRVEYLHAYIGAVLKAVRNGSDTRGYFVWSFMDLYELVKGYE 446
297846874 370 QSYGNPPVYILEN----------GKTMTQDLDLQQKDTPRIEYLDAYIGAVLKAVRNGSDTRGYFVWSFMDLYELLDGYK 439
22328869  453 FSFGLYSVNFSDPHRTRSPKLSAHWYSAFLKGN---TTFLGSQGIMQMQSNFSSSA 505
42571767  435 SSFGLYSVNFSDPHRKRSPKLSAHWYSGFLKGK---PTFLGSQGITQLHSNFSSSR 487
22330338  460 VGFGLYTVNFSDPHRKRSPKLSAYWYSDFLKGE---SAFLDSQGIKELQSKYSSSF 512
297799820 447 FSFGLYSVNFSDPHRKRSPKLSAHWYSAFLKGN---NTFLGSQGITQLQSNFSSSS 499
297846874 440 STFGLYSVNFSDPHLKRSPKLSAHWYSGFLKGKkhlSCFPRHNAIA---------- 485
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap