Conserved Protein Domain Family
PLN02764

?
PLN02764: PLN02764 
glycosyltransferase family protein
Statistics
?
PSSM-Id: 178364
Aligned: 3 rows
Threshold Bit Score: 905.205
Created: 9-Dec-2010
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15234195    1 MGGLKFHVLMYPWFATGHMTPFLFLANKLAEKGHTVTFLIPKKALKQLENLNLFPHNIVFRSVTVPHVDGLPVGTETVSE 80 
15234196    1 MGGLKFHVLMYPWFATGHMTPFLFLANKLAEKGHTVTFLLPKKSLKQLEHFNLFPHNIVFRSVTVPHVDGLPVGTETASE 80 
297799226   1 MGGLRFHVLMYPWFATGHMTPFLYLANKLAEKGHMVTFLLPKKALKQLEHLNLFPHNIVFRSVTIPHVDGLPVGTETVSE 80 
15234195   81 IPVTSADLLMSAMDLTRDQVEGVVRAVEPDLIFFDFAHWIPEVARDFGLKTVKYVVVSASTIASMLVPGGELGVPPPGYP 160
15234196   81 IPVTSTDLLMSAMDLTRDQVEAVVRAVEPDLIFFDFAHWIPEVARDFGLKTVKYVVVSASTIASMLVPGGELGVPPPGYP 160
297799226  81 IPVTSADLLMSAMDLTRDQVEVVLRAVEPDLIFFDFAHWIPQVARDLGIKTVKYVVVSASTIASMLVPGGELGVPPPGYP 160
15234195  161 SSKVLLRKQDAYTMKNLESTNTINVGPNLLERVTTSLMNSDVIAIRTAREIEGNFCDYIEKHCRKKVLLTGPVFPEPDKT 240
15234196  161 SSKVLLRKQDAYTMKKLEPTNTIDVGPNLLERVTTSLMNSDVIAIRTAREIEGNFCDYIEKHCRKKVLLTGPVFPEPDKT 240
297799226 161 SSKVLLRKQDAYTMKNLEP--TIDAGPNLLERVTTSLMNSDVIAIRTVREIEGNFCDYIEKHCRKKVLLTGPMFPEPDKT 238
15234195  241 RELEERWVKWLSGYEPDSVVFCALGSQVILEKDQFQELCLGMELTGSPFLVAVKPPRGSSTIQEALPEGFEERVKGRGVV 320
15234196  241 RELEERWVKWLSGYEPDSVVFCALGSQVILEKDQFQELCLGMELTGSPFLVAVKPPRGSSTIQEALPEGFEERVKGRGLV 320
297799226 239 RELEERWVKWLSGYEPDSVVFCALGTQVILEKDQFQELCLGMELTGSPFLVAVKPPRGSSTIEEALPEGFKERVKGRGVV 318
15234195  321 WGEWVQQPLLLSHPSVGCFVSHCGFGSMWESLLSDCQIVLVPQLGDQVLNTRLLSDELKVSVEVAREETGWFSKESLFDA 400
15234196  321 WGGWVQQPLILSHPSVGCFVSHCGFGSMWESLLSDCQIVLVPQLGDQVLNTRLLSDELKVSVEVAREETGWFSKESLCDA 400
297799226 319 WGGWVQQPLILSHPSVGCFVSHCGFGSMWESLLSDCQIVLVPQLGDQVLNTRLMSDELKVSVEVVREETGWFSKESLRDA 398
15234195  401 INSVMKRDSEIGNLVKKNHTKWRETLTSPGLVTGYVDNFIESLQDL---------VSGTNHV 453
15234196  401 VNSVMKRDSELGNLVRKNHTKWRETVASPGLMTGYVDAFVESLQDL---------VSGTTHD 453
297799226 399 INSVMKRDSEIGNLVKKNHTKWRETLASPGLLSGYVDNFIESLQDLwqcviikicINQTSVF 460
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap