Conserved Protein Domain Family
PLN02609

?
PLN02609: PLN02609 
catalase
Statistics
?
PSSM-Id: 215328
View PSSM: PLN02609
Aligned: 34 rows
Threshold Bit Score: 825.915
Threshold Setting Gi: 167998987
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PLN02609 is a member of the superfamily cl09506.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 168057984   8 LNLSLTVGESGTVTLEDLHLFEKNAHFNRERVPERVVHAKGAGAHGYFEVTKDVSDLCKAGLFSEVGKRTPVFARFSTVT 87
gi 167998987  16 LCLSVTVGESGTLTFEDLHLFEKNAHFNRERIPERVVHAKGAGAHGYFEVTHDVTDLCKAKLFDEVGKKTPVFARFSTVT 95
gi 168054177  28 NTSSMTIGSRGPVLLEDYHLVEKIANFHRERIPERIVHARGAGAKGYFEVTHDITHLTCADFLRGVGVQTPLIARFSTVI 107
gi 168050281  35 DNNSLTIGESGNTLFEDLHLFEKNAHFNRERIPERVVHAKGAGAHGYFEVTHDVTDICKAAFLSEVGKRTPVLGRWSTVT 114
gi 42571565   28 NISSLTIGERGPVLLEDYHLIEKVANFTRERIPERVVHARGISAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVV 107
gi 18394888   28 NISSLTIGERGPVLLEDYHLIEKVANFTRERIPERVVHARGISAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVV 107
gi 79318278   28 NISSLTIGERGPVLLEDYHLIEKVANFTRERIPERVVHARGISAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVV 107
gi 115443787  28 DNEALTVGPRGPILLEDYHLIEKVAHFARERIPERVVHARGASAKGFFECTHDVTDITCADFLRSPGAQTPVIVRFSTVI 107
gi 242063776   3 ptkALTVGPRGPILLEDYHLIEKVAHFARERIPERVVHARGASAKGFFECTHDVASLTCADFLRSPGVRTPVIVRFSTVI 82
gi 302786724  40 DNNSVTVGQSGHLLFEDVHLFEKQARLNRERVPERFVHAKGAGAHGYFEVTKDVSNLCKAKFLSEPGKRTPVFARFSSVA 119
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 168057984  88 GESGYADTARDPRGFSLKFYTEEGNWDMVGNNTPVFFVRDAAKFPDLIHSQKRNPQTHMKDPNAFWDFLSLVPESLHQVL 167
gi 167998987  96 GESGFPDTARDPRGFALKFYTEEGNWDMVGNNTPVFFVRDALKFPDLIHSQKRNPQTHMKDPNAFWDFLSLVPESLHQVL 175
gi 168054177 108 HEKGSPETLPDPRGFAVKMYTREGNFDMVGNNMPVFFVRDAMQFPDVIHAMKPNPKSNVQEWWRIMDYLSYIPESTHMFF 187
gi 168050281 115 GESGFPDTARDPRGFSIKFYTEEGNWDMVGNNTPVFFVRDAIKFPDLIHSQKRNPATHMKDPNAFWDFLSLVPESLHQVL 194
gi 42571565  108 HERASPETMRDIRGFAVKFYTREGNFDLVGNNTPVFFIRDGIQFPDVVHALKPNPKTNIQEYWRILDYMSHLPESLLTWC 187
gi 18394888  108 HERASPETMRDIRGFAVKFYTREGNFDLVGNNTPVFFIRDGIQFPDVVHALKPNPKTNIQEYWRILDYMSHLPESLLTWC 187
gi 79318278  108 HERASPETMRDIRGFAVKFYTREGNFDLVGNNTPVFFIRDGIQFPDVVHALKPNPKTNIQEYWRILDYMSHLPESLLTWC 187
gi 115443787 108 HERGSPETIRDPRGFAVKFYTREGNWDLLGNNFPVFFIRDGIKFPDVIHAFKPNPRSHVQEYWRVFDFLSHHPESLHTFF 187
gi 242063776  83 HERGSPETIRDPRGFAVKFYTREGNWDLLGNNFPVFFIRDGIKFPDVIHAFKPNPRSHVQEYWRVFDFLSHLPESLHTFF 162
gi 302786724 120 AERGFTDLARDVRGFAVKFYTEEGNWDMTGNNTPVFWVRDPLKFPDFVHSQKRNPKTNAKDPNAFWDFLSLVPESMHQLL 199
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 168057984 168 ITFSPRGVPDGHRHMHGYGSHTFKWVNKEGKAHWVKFHFISDQGIKN-LTHERAVELAGINPDYSTEDLFQNIQNGNGPS 246
gi 167998987 176 ITFSPRGVPDGHRHMHGYGSHTYKWINKEGKAHWVKFHFISDQGIKN-LTHERAVELAGINPDYSTEDLFQNIQKGNGPS 254
gi 168054177 188 WWLDDWGVPTDYRHMDGYTVHTFKLINKEGKETLIKWHWRPTCGLKF-LLEDEAAKVVAKCHSHATKDLYDTIASGSFPE 266
gi 168050281 195 ITFSPRGVPDGHRHMHGYGSHTYKWVNKEGKAHWVKFHFLSDQGIKN-LTHERAVELAGINPDYSTEDLFQNIQNGNGPS 273
gi 42571565  188 WMFDDVGIPQDYRHMEGFGVHTYTLIAKSGKVLFVKFHWKPTCGIKN-LTDEEAKVVGGANHSHATKDLHDAIASGNYPE 266
gi 18394888  188 WMFDDVGIPQDYRHMEGFGVHTYTLIAKSGKVLFVKFHWKPTCGIKN-LTDEEAKVVGGANHSHATKDLHDAIASGNYPE 266
gi 79318278  188 WMFDDVGIPQDYRHMEGFGVHTYTLIAKSGKVLFVKFHWKPTCGIKN-LTDEEAKVVGGANHSHATKDLHDAIASGNYPE 266
gi 115443787 188 FLFDDVGIPTDYRHMDGFGVNTYTFVTRDAKARYVKFHWKPTCGVSC-LMDDEATLVGGKNHSHATQDLYDSIAAGNFPE 266
gi 242063776 163 FLFDDVGVPTDYRHMEGFGVNTYTFVNAAGKSHYVKFHWKPTCGVRSiLTDEEAALVGGRNHSHATQDLYDSIAAGSFPE 242
gi 302786724 200 ITFSPRGVPATYRNMNGYGSHTFKWVNKERKAHWVKFHLVTEHGIKN-LTHEEAVSLSGSKPDYATEDLLTSIEEGNFPA 278
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 168057984 247 WTFKVQVMPLEDAPSYRWDPFDLTKVWPHADYPLREVGKLKLDRNPTNYFAEVEQASFSPAHMVPGIEASPDRVLQFRLF 326
gi 167998987 255 WTFKVQVMPLEDAASYRYDPFDLTKVWPHKDYPLREVGKLKLDRNPTNHFAEVEQSSFSPAHMVPGIEASPDRVLQARLF 334
gi 168054177 267 WRLYIQTMNPSDEDKYDFDPMDTTCIWPEELFPLQPVGRMVLNKNLDNFFSENEMLAFSPGVVPPGITYSNDKMLQCRIF 346
gi 168050281 274 WTFKVQVMPLEDAPQYRFDPFDLTKVWSHKDYPLREVGKLKFDRNPTNYFAEVEQASFSPGHFVPGIEASPDRVLQARLF 353
gi 42571565  267 WKLFIQTMDPADEDKFDFDPLDVTKIWPEDILPLQPVGRLVLNRTIDNFFNETEQLAFNPGLVVPGIYYSDDKLLQCRIF 346
gi 18394888  267 WKLFIQTMDPADEDKFDFDPLDVTKIWPEDILPLQPVGRLVLNRTIDNFFNETEQLAFNPGLVVPGIYYSDDKLLQCRIF 346
gi 79318278  267 WKLFIQTMDPADEDKFDFDPLDVTKIWPEDILPLQPVGRLVLNRTIDNFFNETEQLAFNPGLVVPGIYYSDDKLLQCRIF 346
gi 115443787 267 WKLFVQVIDPEEEERFDFDPLDDTKTWPEDEVPLRPVGRLVLNRNVDNFFNENEQLAFGPGLVVPGIYYSDDKMLQCRVF 346
gi 242063776 243 WKLFVQVMDPDTEDQYDFDPLDDTKTWPEDLLPLQPVGRLVLDKNVDNFFNENEQLAFGPGLVVPGIYYSDDKMLQCRVF 322
gi 302786724 279 WKFYVQVMPLEDAPKYKWDPFDLTKVWLHKDYPLMEVGRLVLDRNVENYHAEVEQAAFSPGSFVPGIEASPDRILQSRLF 358
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 168057984 327 AYDDAARYRIGGNYLQVPINQcPFAKVQNYSRDGQMTVTDNgGSKPNYYPNSHEELPRPDPSqPEVHPYehaggtvsKAP 406
gi 167998987 335 AYDDAGRYRLGSNHLQIPINQcPFARVQNYSRDGLMTVTENgGSKPNYYPNSFPDLPRPDASqPDVHPY--------KTP 406
gi 168054177 347 AYGDTQRHRLGPNYLLLPANA-PKNAHHNNHHEGFMNFLHR-DEEVNYWPSRFDSLRMSERF-PISKAHvs-----gIRE 418
gi 168050281 354 AYDDASRYRLGSNYLQIPVNRcPFAKVQTYARDGFMNVSDNgGSNPNYYPNSFEDLPRPDPSqPDVHPYkhdggvvsRTP 433
gi 42571565  347 AYGDTQRHRLGPNYLQLPVNA-PKCAHHNNHHEGFMNFMHR-DEEINYYPSKFDPVRCAEKV-PTPTNSyt-----gIRT 418
gi 18394888  347 AYGDTQRHRLGPNYLQLPVNA-PKCAHHNNHHEGFMNFMHR-DEEINYYPSKFDPVRCAEKV-PTPTNSyt-----gIRT 418
gi 79318278  347 AYGDTQRHRLGPNYLQLPVNA-PKCAHHNNHHEGFMNFMHR-DEEINYYPSKFDPVRCAEKV-PTPTNSyt-----gIRT 418
gi 115443787 347 AYADTQRYRLGPNYLMLPVNA-PKCAHHNNHYDGAMNFMHR-DEEVDYYPSRHAPLRHAPPT-PITPRPvv-----gRRQ 418
gi 242063776 323 AYADTQRYRLGPNYLMLPVNA-PRCAHHNNHYDGAMNFMHR-DEEVDYYPSRHAPLRQAPPV-PIPARPvv-----gKRQ 394
gi 302786724 359 AYDDAARYRIGTNFHDVPINK-PIVKVQTYSRDGAMVVSDNgGSKPNYYPNSYDNLPQNDPTqPDVHPHegg--tvgRFP 435
                        410       420       430       440       450       460       470
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 168057984 407 PRKWSEQDDYEQPRMLWQKMSKEDQGQTAKNIAGHIQGAKESIIERQ--MGVFRRCDPSLADKVEEMLGMKKKS 478
gi 167998987 407 PRKWSMQDDYEQPRALWQTMSKEDQGQTAKNIAGHIQGAQEFIIQRQ--MGIFKRCDPSLAQKVEEMLEMKRKS 478
gi 168054177 419 KTVIPKENNFIQPGNRYRTWDHDRQERFIGRMVTALSDPRLTHEIRAiwISYMSQCDKTLGQKLASRLSTRATM 492
gi 168050281 434 PRKWTEQDDYEQPRALWQAMSAQDRGQTAKNIAGHIMGAKEMIIQRQ--MGVFRKCDESLASKVEEMLAVKRIG 505
gi 42571565  419 KV------------------------RFLPCLL----------------------------------------- 427
gi 18394888  419 KCVIKKENNFKQAGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRGiwISYWSQADRSLGQKLASRLNVRPSI 492
gi 79318278  419 KCVIKKENNFKQAGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRGiwISYWSQ-------KLASRLNVRPSI 485
gi 115443787 419 KATIHKQNDFKQPGERYRSWAPDRQERFIRRFAGELAHPKVSPELRAiwVNYLSQCDESLGVKIANRLNVKPSM 492
gi 242063776 395 KETIRKPNDFKQPGERYRSWDADRQERFVRRFADSLGHPKVSQELRSiwIDLLSKCDASLGMKIATRLNMKPNM 468
gi 302786724 436 PRKWEEQDDYEQPRMLWKLMSEEDKEQTVSNIANHIRGAAEFIQERQ--MGLFRKCDGDLASRIEKKLAEKKKS 507
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap