Conserved Protein Domain Family
PLN02495

?
PLN02495: PLN02495 
oxidoreductase, acting on the CH-CH group of donors
Statistics
?
PSSM-Id: 215273
View PSSM: PLN02495
Aligned: 14 rows
Threshold Bit Score: 712.765
Threshold Setting Gi: 159471299
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PLN02495 is a member of the superfamily cl27592.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 168058192   5 AAEGPDLSVTVNGLKFANPFVIGSGPPGTNYTVMKRAFEEGWGGVIAK---TVSLDSSKVVNVTPRYARLKASGAPGTKP 81
gi 15229529   46 AESEPDLSVTVNGLKMPNPFVIGSGPPGTNYTVMKRAFDEGWGAVIAK---TVSLDASKVINVTPRYARLRTGSNGSAKT 122
gi 159471299  55 VTSGPDLSVEVNGMKLPNPFIIGSGPPGTNYQVMKKAFDEGWGGVICKaspTLSLDSSKVVNVTPRYAKIR-----DYSN 129
gi 168015012   5 AAEGPDLSVTVNGLKLPNPFVIGSGPPGTNYTVMKRAFDEGWGGVIAK---TVSLDSSKVVNVTPRYARLKASALSGKKP 81
gi 225456230  41 GQAEPDLSVTVNGLHMPNPFVIGSGPPGTNYTVMKRAFDEGWGAVIAK---TVSLDAAKVINVTPRYARLRVGANGSAKG 117
gi 224125864  44 NQGEPDLSVTVNGLHMPNPFVIGSGPPGTNYTVMKRAFDEGWGAVIAK---TVSLDAAKVINVTPRYARLRAGANGSAKG 120
gi 255088383  58 PTSGPDLSVTVNGLKFPNPFVIGSGPPGTNYTVMKKAFDEGWGGVIAK---TVSLNADLVKNVTPRYAKMKS----EDGA 130
gi 255586410  48 TKVEPDLSVTVNGLKMPNPFVIGSGPPGTNYTVMKRAFDEGWGAVIAK---TVSLDAEKVINVTPRYARLRAGVNGSAKG 124
gi 302761068  33 ADGAPDLSVSVNGLRLPNPFVIGSGPPGTNYTVMKKAFDEGWGAVISK---TLSLDSTKVINVTPRYARMRS---GNGPK 106
gi 302769089  33 ADGAPDLSVSVNGLRLPNPFVIGSGPPGTNYTVMKKAFDEGWGAVISK---TLSLDSTKVINVTPRYARMRS---GNGPK 106
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 168058192  82 EVIGWQNIELISDRPFETMLAEMKQLKEEFPDRILIASIMEEYNRDAWEEIIERVEEAGVDAFEINFSCPHGMPERKMGM 161
gi 15229529  123 DVIGWQNIELISDRPLETMLKEFERLKKEYPDRILIASVMEEYNKTAWEELIDRVEQTGVDALEINFSCPHGMPERRMGA 202
gi 159471299 130 RVFGWQNFELISDRPFDVMLAEMKRLREEYPNRMLIASIMEEYNKDAWEEIIGRCEEIKVDAFEINFSCPHGLPERRMGM 209
gi 168015012  82 EVIGWENIELISDRPFETMLAEMKQLKEEYPDRILIASIMEEYNRDAWEEIIERVEETGVDAFEVNFSCPHGMPERKMGM 161
gi 225456230 118 QIIGWENIELISDRPLETMLKEFKQLKEEYPDRILIASIMEEYDKAAWEELIDRVEQTGIDALEINFSCPHGMPERKMGA 197
gi 224125864 121 QIIGWENIELISDRPLETMLKEFKQLKEEYPDRILIASIMEEYNKAAWEELIDRVEQTGIDALEINFSCPHGMPERKMGA 200
gi 255088383 131 EVLGWQNIELISDRSFEVMLAEFKQLKEEYPDRILIASIMDEYKKENWVEVVRRCEEVGVDAFEINFSCPHGMPERKMGA 210
gi 255586410 125 QIIGWENIELISDRPLETMLKEFKQLKEEYPERILIASIMEEYDKAAWEELIDRVEQTGIDAIEVNFSCPHGMPERKMGA 204
gi 302761068 107 DVIGWENIELISDRPFETMLAELRRLKQEYPDRILIGSIMEEYDKDAWEEIIERVEATGVDALEINFSCPHGMPERKMGA 186
gi 302769089 107 DVIGWENIELISDRPFETMLAELRRLKQEYPDRILIGSIMEEYDKDAWEEIIERVEATGVDALEINFSCPHGMPERKMGA 186
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 168058192 162 AMGQDCSVLEEVCGWINAKATIPVWAKMTPNITDITQPARTALRSGCEGVAAINTIMSV-------MGINLDTLRPEPCV 234
gi 15229529  203 AVGQDCALLDEVCGWINAKATVPVWAKMTPNITDITEPARVSLKSGCEGIAAINTIMSV-------MGIDMKTLRPEPCV 275
gi 159471299 210 AMGQDPEVLGEVCGWINKAATVPVWAKMTPNVTDISFPADVALKAGCEGVAAINTIQCIsathyigAGHDMRMLGGGPPV 289
gi 168015012 162 AMGQDCSVLDEVCGWINAKATIPVWAKMTPNITDITQPARVALNAGCEGVAAINTITSV-------MGINLDTLRPEPCV 234
gi 225456230 198 AVGQDCALLEEVCGWINAKATVPVWAKMTPNITDITQPARVALSSGCEGVSAINTIMSV-------MGINLNTLRPEPCV 270
gi 224125864 201 AVGQDCALLEEVCGWINAKATVPVWAKMTPNITDITQPARVSLKSGCEGVAAINTIMSV-------MGINLKTLRPEPCV 273
gi 255088383 211 AMGQDCTVLDEVCGWVKEVATVPVWAKMTPNITDITEPANVCLEKGMDGIAAINTIMSI-------MGVNLDTLAPEPCV 283
gi 255586410 205 AVGQDCGLLEEICGWVNAKATVPVWAKMTPNITDITEPARAALRSGCEGISAINTIMSV-------MGINLKTLRPEPCV 277
gi 302761068 187 AVGKDCDLLGEVCSWINAKATVPVWAKMTPNVTDITQPARTAIEAGCEGLSAINTITSI-------MGINLDTLRPEPCV 259
gi 302769089 187 AVGKDCDLLGEVCSWINAKATVPVWAKMTPNVTDITQPARTAIEAGCEGLSAINTITSI-------MGINLDTLRPEPCV 259
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 168058192 235 EGYSTPGGYSCKAVRPIALAKVMSIAQMMKTEFPgQDRSLSGIGGVESGSHAAEFILLGASTVQVCTGVMLHGYGHVKTM 314
gi 15229529  276 EGYSTPGGYSYKAVRPIALAKVMNIAKMMKSEFS-EDRSLSGIGGVETGYDAAEFILLGSNTVQVCTGVMMHGYGHVKTL 354
gi 159471299 290 HHPPGIGWLRAATAPGLAAASDVHLSR----------RSLSGIGGVETGGDAAEFILLGSDTVQVCTGVMIHGYPVVKNL 359
gi 168015012 235 EGYSTPGGYSSKAVRPIALAKVMSIAQMMKAEFPgQNKSLSGIGGIETGDHAAEFILLGADTVQVCTGVMLHGYGHVKHL 314
gi 225456230 271 EGYSTPGGYSCKAVHPIALGKVMSIAKMMKAEFG-EDYSLSGIGGVETGGDAAEFILLGANTVQVCTGVMMHGYGLVKKL 349
gi 224125864 274 EGYSTPGGYSSKAVHPIALGKVMSIAKMMKSEFDlEQYSLSGIGGVETGSDAAEFILVGANTVQVCTGVMMHGYGLVKKL 353
gi 255088383 284 EGHSTPGGYSYKAVRPIALAKCMAIAQMIKKEFP--DRTLSGIGGIDTGGHAAEFILLGSDTVQVCTGVMIHGYPLVQNL 361
gi 255586410 278 EGYSTPGGYSSKAVHPIALGKVMNIAKMMKSEFNiDQYSLSGIGGVETGSDAAEFILLGANTVQVCTGVMMHGYGLVKKL 357
gi 302761068 260 EGYSTPGGYSSRAVRPIALAKVMAIAQMLKSEYPdRNISLSGIGGVESGDNAAEFILLGANTVQVCTGVMMYGYPLVKRL 339
gi 302769089 260 EGYSTPGGYSSRAVRPIALAKVMAIAQMLKSEYPdRNISLSGIGGVESGDNAAEFILLGANTVQVCTGVMMYGYPLVKRL 339
                        330       340       350       360       370       380       390
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 168058192 315 CTELQAFMDKHGFISIEDFRGASLGYFTTHADLVQRQKEAVKIKKKQRKGLSSDKDWTGEGFVAETETMVSN 386
gi 15229529  355 CAELKDFMKQHNFSTIEEFRGHSLQYFTTHTDLVKRQKEAVEQRKAEKRGLKSDKDWTGDGFVKETESMVSN 426
gi 159471299 360 CGGLQKFMQKHDFKSIAEFKGKSLPYVTVHSELVKRQRDAISAKKA-RQGLANDAEWSGEDFVKNADSMAVN 430
gi 168015012 315 CTDLQAFMDKHGFTSIEDFRGASLGYFTTHADLVRRQNEAIQHKKKERKGLASDKDWTGEGFVKETETMVSN 386
gi 225456230 350 CSELKDFMKMHNFSSIEDFRGASLEYFTTHTDLVQRQQEAIRQRKAIRQGLQSDKDWTGDGFVKESESMVSN 421
gi 224125864 354 CDELKDFMKMHNFSSIEDFRGASLEYFTTHMDLVRRQQEAIQQRKAIKKGLQSDKDWTGDGFVKETESMVSN 425
gi 255088383 362 CAELQEFMGKHGFESIAEFKGMSLEYFTTHTDLVARQKEAIEKKKKAKVGIESDDKWTGEGFVAETESMVSN 433
gi 255586410 358 NDELKDFMKMHNFSSIEDFRGVSLDYFTTHTDLVRRQKEAIEQRKAVKRGLQSDKDWTGDGFVKESESMVSN 429
gi 302761068 340 CKELQAFMAKHNFTSLDDFRGTSLQYMTTHTDLVQRQQEAIRSRRAARKGLASDKDWTGDGFVKETELMVSN 411
gi 302769089 340 CKELQAFMAKHNFTSLDDFRGTSLQYMTTHTDLVQRQQEAIRSRRAARKGLASDKDWTGDGFVKETELMVSN 411
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap