Conserved Protein Domain Family
PLN02468

?
PLN02468: PLN02468 
putative pectinesterase/pectinesterase inhibitor
Statistics
?
PSSM-Id: 178087
Aligned: 8 rows
Threshold Bit Score: -1
Created: 9-Dec-2010
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
297806485   1 MSSYGRLDEHEQSKLEASRKTKKRIAIIAISSIVLVCIVVGAIVGTTAYDNGKKs-PTESNGEPISVSVKAVCDVTLHKD 79 
15228355    2 SSPYGKVDEREHVRLEARRKTRKNIAIIAVSLVILAGIVIGAVFGTMAHKKSPEtvETNNNGDSISVSVKAVCDVTLHKE 81 
15238377    1 MSSYGRLDEHEQAKLEASRKTKKRIAIIAISSIVLVCIVVGAVVGTTARDNSKKp-PTENNGEPISVSVKALCDVTLHKE 79 
224113327   4 LKAYGKLDEAEQARLEARRRTRKRITIISLSSILLVAIVVAAVVGTHASSGNS---KKGGADKSLSTSVKAVCDVTLYKD 80 
224100545   4 LKAYGKLDEAEQARLEARRRTRKRITIISLSSILLVAIVVAAVVGTRAASGNS---KKGGADKSISTSVKAVCDVTLYKD 80 
225465371   7 FKAYGKVNEAEQERLLARRKTRRRITIISLSSIILVAVIVAAVVGTTTNSGG----KSKNAGNSVSTSIKAVCDVTLYPD 82 
255549456   4 FKAYGKVDEAEQATLEARRRTRKRITIISLSSILLAAIVVAAVVGTHASGGNSN--NGGDQAKPISTSVKAVCDVTLYKD 81 
297829618   2 SSPYGKVDEHEHVRLQARRKTRKNIAIIAVSLVILAGIVIGAVFGTMAHKKSSEtvETNNNGDSISVSVKAVCDVTLHKD 81 
15228355    2 SSPYGKVDEREHVRLEARRKTRKNIAIIAVSLVILAGIVIGAVFGTMAHKKSPEtvETNNNGDSISVSVKAVCDVTLHKE 81 
15238377    1 MSSYGRLDEHEQAKLEASRKTKKRIAIIAISSIVLVCIVVGAVVGTTARDNSKKp-PTENNGEPISVSVKALCDVTLHKE 79 
224113327   4 LKAYGKLDEAEQARLEARRRTRKRITIISLSSILLVAIVVAAVVGTHASSGNS---KKGGADKSLSTSVKAVCDVTLYKD 80 
224100545   4 LKAYGKLDEAEQARLEARRRTRKRITIISLSSILLVAIVVAAVVGTRAASGNS---KKGGADKSISTSVKAVCDVTLYKD 80 
225465371   7 FKAYGKVNEAEQERLLARRKTRRRITIISLSSIILVAVIVAAVVGTTTNSGG----KSKNAGNSVSTSIKAVCDVTLYPD 82 
255549456   4 FKAYGKVDEAEQATLEARRRTRKRITIISLSSILLAAIVVAAVVGTHASGGNSN--NGGDQAKPISTSVKAVCDVTLYKD 81 
297829618   2 SSPYGKVDEHEHVRLQARRKTRKNIAIIAVSLVILAGIVIGAVFGTMAHKKSSEtvETNNNGDSISVSVKAVCDVTLHKD 81 
297806485  80 KCFETIGTAPNASQLNPEELFKYAVKITITELSKVLDGFSNGEHm------DNATSAAMGACVELIGLAVDQLNETMTSM 153
15228355   82 KCFETLGSAPNASSLNPEELFRYAVKITIAEVSKAINAFSSSLG-------DEKNNITMNACAELLDLTIDNLNNTLTSS 154
15238377   80 KCFETLGSAPNASRSSPEELFKYAVKVTITELSKVLDGFSNGEHm------DNATSAAMGACVELIGLAVDQLNETMTSS 153
224113327  81 SCYNSLAPVAKPDQLQPEELFKLAIQVAKNELSKASQHFSKDGGvlyngvkDNMTITALENCQELLSLALDHLDNSLEAG 160
224100545  81 SCYNNLAPVAKPDQLQPEELFKLAIQVAKNELSKASQHFSKDGGvlyngvkDNMTITALENCQELLSLALDHLDNSLEAG 160
225465371  83 SCYNSLAPMVKSSQLKPEDLFNMSMEVALNELHRTFQRFSEHEGfkg--itDKMLAGALDDCYELLDLAIDNLNSSLSSS 160
255549456  82 SCYSSLAPFAKPNNLQPEELFKLSIQVALDEISKASQYFINNGQflgglndNNMINAALKDCQDLLDLAIDRLNSSLSSA 161
297829618  82 KCFETLGSAPNASSLNPEELFKYAVKITITEVSKALNAFSSSLG-------DEKNNITMNACAELLDLTIDNLNNTLTSS 154
15228355   82 KCFETLGSAPNASSLNPEELFRYAVKITIAEVSKAINAFSSSLG-------DEKNNITMNACAELLDLTIDNLNNTLTSS 154
15238377   80 KCFETLGSAPNASRSSPEELFKYAVKVTITELSKVLDGFSNGEHm------DNATSAAMGACVELIGLAVDQLNETMTSS 153
224113327  81 SCYNSLAPVAKPDQLQPEELFKLAIQVAKNELSKASQHFSKDGGvlyngvkDNMTITALENCQELLSLALDHLDNSLEAG 160
224100545  81 SCYNNLAPVAKPDQLQPEELFKLAIQVAKNELSKASQHFSKDGGvlyngvkDNMTITALENCQELLSLALDHLDNSLEAG 160
225465371  83 SCYNSLAPMVKSSQLKPEDLFNMSMEVALNELHRTFQRFSEHEGfkg--itDKMLAGALDDCYELLDLAIDNLNSSLSSS 160
255549456  82 SCYSSLAPFAKPNNLQPEELFKLSIQVALDEISKASQYFINNGQflgglndNNMINAALKDCQDLLDLAIDRLNSSLSSA 161
297829618  82 KCFETLGSAPNASSLNPEELFKYAVKITITEVSKALNAFSSSLG-------DEKNNITMNACAELLDLTIDNLNNTLTSS 154
297806485 154 kdKTTSPLKSVDDLRTWLSSVETYQETCMDALVeankPGLTTFGEN-HLKNSTEMTSNALAIITWLGKIADTVKFRRRRL 232
15228355  155 snGDVTVPELVDDLRTWLSSAGTYQRTCVETLA----PDMRPFGES-HLKNSTELTSNALAIITWLGKIADSFKLRRRLL 229
15238377  154 -------LKNFDDLRTWLSSVGTYQETCMDALVeankPSLTTFGEN-HLKNSTEMTSNALAIITWLGKIADTVKFRRRRL 225
224113327 161 --HGVNVIDIVDDLRSWLSTSGTCYQTCIDGLSe---TKLEATAHD-YLKNSSELTSNSLAIITWISKVASSVNIHRRLM 234
224100545 161 --HGVSVIDIVDDLRTWLSTSGTCYQTCIDGLSe---TKLKATAND-YLKSSSELTSNSLAIITWISKVASSVNIHRRLL 234
225465371 161 -------LDNFDDLKTWLSAAGTYQETCINGFEs---GNLRSSVLE-FLKNSTEFSSNSLAIITEISKLAGSISS-RRLM 228
255549456 162 --NDVSLIDVADDFRSWLSAAGSYQQTCIDGLKe---ANLKSTAQNyYLKNTTELTSNSLAIITWIYKIASSVKM-RRLM 235
297829618 155 anGGVTVPELVDDLRTWLSSAETYQETCVETLA----PDMKPFGES-HLKNSTELTSNALAIITWLGKIADSFKLRRRLL 229
15228355  155 snGDVTVPELVDDLRTWLSSAGTYQRTCVETLA----PDMRPFGES-HLKNSTELTSNALAIITWLGKIADSFKLRRRLL 229
15238377  154 -------LKNFDDLRTWLSSVGTYQETCMDALVeankPSLTTFGEN-HLKNSTEMTSNALAIITWLGKIADTVKFRRRRL 225
224113327 161 --HGVNVIDIVDDLRSWLSTSGTCYQTCIDGLSe---TKLEATAHD-YLKNSSELTSNSLAIITWISKVASSVNIHRRLM 234
224100545 161 --HGVSVIDIVDDLRTWLSTSGTCYQTCIDGLSe---TKLKATAND-YLKSSSELTSNSLAIITWISKVASSVNIHRRLL 234
225465371 161 -------LDNFDDLKTWLSAAGTYQETCINGFEs---GNLRSSVLE-FLKNSTEFSSNSLAIITEISKLAGSISS-RRLM 228
255549456 162 --NDVSLIDVADDFRSWLSAAGSYQQTCIDGLKe---ANLKSTAQNyYLKNTTELTSNSLAIITWIYKIASSVKM-RRLM 235
297829618 155 anGGVTVPELVDDLRTWLSSAETYQETCVETLA----PDMKPFGES-HLKNSTELTSNALAIITWLGKIADSFKLRRRLL 229
297806485 233 MATGdakvvvADLPMMEGRRLLESGD-LRKKATIVVAKDGSGKYRTIGEALAEVEEKNEKPTIIYVKKGVYLENVRVEKK 311
15228355  230 TTAD------VEVDFHAGRRLLQSTD-LRKVADIVVAKDGSGKYRTIKRALQDVPEKSEKRTIIYVKKGVYFENVKVEKK 302
15238377  226 LETGnakvvvADLPMMEGRRLLESGD-LKKKATIVVAKDGSGKYRTIGEALAEVEEKNEKPTIIYVKKGVYLENVRVEKT 304
224113327 235 NYEDqe---mPKWLHPEDRKLLQSSD-LKKKADVVVAKDGSGKYKRISDALKNVPEKSKKRYVIYVKKGIYFENVRVEKK 310
224100545 235 NYEDqe---mPKWQHPEARKLLQSSD-L-NKADAIVAQDGSGKYKRITDALKDVPEKSEKRYVIYVKKGIYFENVRIEKK 309
225465371 229 GLPEdk---vPKWLSAKDRKLLQSSStLKKKADAVVATDGSGKYKTISEALKAVPDKSKKSFVIYVKKGVYNENVRVEKS 305
255549456 236 SYAEhdkvnlPRWLHQNDRKLLQSND-LKKKANAVVAKDGSGKYKTISDALKAVPDKSKKRFIIYVKKGIYTENVRVEKP 314
297829618 230 TTVD------VEVDVHAGRRLLQSTD-LRKVADIVVAKDGSGKYRTISRALEDVPEKSEKRTIIYVKKGVYFENVKVEKK 302
15228355  230 TTAD------VEVDFHAGRRLLQSTD-LRKVADIVVAKDGSGKYRTIKRALQDVPEKSEKRTIIYVKKGVYFENVKVEKK 302
15238377  226 LETGnakvvvADLPMMEGRRLLESGD-LKKKATIVVAKDGSGKYRTIGEALAEVEEKNEKPTIIYVKKGVYLENVRVEKT 304
224113327 235 NYEDqe---mPKWLHPEDRKLLQSSD-LKKKADVVVAKDGSGKYKRISDALKNVPEKSKKRYVIYVKKGIYFENVRVEKK 310
224100545 235 NYEDqe---mPKWQHPEARKLLQSSD-L-NKADAIVAQDGSGKYKRITDALKDVPEKSEKRYVIYVKKGIYFENVRIEKK 309
225465371 229 GLPEdk---vPKWLSAKDRKLLQSSStLKKKADAVVATDGSGKYKTISEALKAVPDKSKKSFVIYVKKGVYNENVRVEKS 305
255549456 236 SYAEhdkvnlPRWLHQNDRKLLQSND-LKKKANAVVAKDGSGKYKTISDALKAVPDKSKKRFIIYVKKGIYTENVRVEKP 314
297829618 230 TTVD------VEVDVHAGRRLLQSTD-LRKVADIVVAKDGSGKYRTISRALEDVPEKSEKRTIIYVKKGVYFENVKVEKK 302
297806485 312 KWNVVMVGDGQSKTIVSAGLNFIDGTPTFETATFAVFGKGFMARDMGFINTAGPTKHQAVALMVSADLSVFYKCTMDAFQ 391
15228355  303 MWNVIVVGDGESKSIVSGRLNVIDGTPTFKTATFAVFGKGFMARDMGFINTAGPSKHQAVALMVSADLTAFYRCTMNAYQ 382
15238377  305 KWNVVMVGDGQSKTIVSAGLNFIDGTPTFETATFAVFGKGFMARDMGFINTAGPAKHQAVALMVSADLSVFYKCTMDAFQ 384
224113327 311 QWNVMMIGDGMKETIVSASLNVVDGTPTFSTATFAVFGKGFIARDMGFRNTAGAIKHQAVALMSNADMSAFYRCSMDAFQ 390
224100545 310 QWNVMMIGDGMNATIVSASLNVVDGTPTFSTATFAVFGKGFIARDMGFRNTAGAIKHQAVALMSNADMSAFYRCSMDAFQ 389
225465371 306 KWNVLMIGDGMNKTVVSGKLNFVDGTPTFSTATFAVFGKGFVAREMGFRNTAGAIKHQAVALMSSADQTVFYRCLIDAFQ 385
255549456 315 KWNVVIVGDGMNATIVSGSLNFVDGTPTFSTATFAVFGKGFIARDMGFRNTAGPIKHQAVALMSTADMSVFYRCSFDAFQ 394
297829618 303 MWNVVVVGDGESKSIVSGRLNVIDGTPTFKTATFAVFGKGFMARDMGFINTAGPSKHQAVALMVSADLAAFYRCTMNAYQ 382
15228355  303 MWNVIVVGDGESKSIVSGRLNVIDGTPTFKTATFAVFGKGFMARDMGFINTAGPSKHQAVALMVSADLTAFYRCTMNAYQ 382
15238377  305 KWNVVMVGDGQSKTIVSAGLNFIDGTPTFETATFAVFGKGFMARDMGFINTAGPAKHQAVALMVSADLSVFYKCTMDAFQ 384
224113327 311 QWNVMMIGDGMKETIVSASLNVVDGTPTFSTATFAVFGKGFIARDMGFRNTAGAIKHQAVALMSNADMSAFYRCSMDAFQ 390
224100545 310 QWNVMMIGDGMNATIVSASLNVVDGTPTFSTATFAVFGKGFIARDMGFRNTAGAIKHQAVALMSNADMSAFYRCSMDAFQ 389
225465371 306 KWNVLMIGDGMNKTVVSGKLNFVDGTPTFSTATFAVFGKGFVAREMGFRNTAGAIKHQAVALMSSADQTVFYRCLIDAFQ 385
255549456 315 KWNVVIVGDGMNATIVSGSLNFVDGTPTFSTATFAVFGKGFIARDMGFRNTAGPIKHQAVALMSTADMSVFYRCSFDAFQ 394
297829618 303 MWNVVVVGDGESKSIVSGRLNVIDGTPTFKTATFAVFGKGFMARDMGFINTAGPSKHQAVALMVSADLAAFYRCTMNAYQ 382
297806485 392 DTMYAHAQRQFYRDCVILGTVDFIFGNAAVVFQNCEILPRRPMEGQQNTITAQGRKDPNQNTGISIHNCTIKPLDNLTDI 471
15228355  383 DTLYVHAQRQFYRECTIIGTVDFIFGNSASVLQSCRILPRRPMKGQQNTITAQGRTDPNMNTGISIHRCNISPLGDLTDV 462
15238377  385 DTMYAHAQRQFYRDCVILGTVDFIFGNAAVVFQKCEILPRRPMKGQQNTITAQGRKDPNQNTGISIHNCTIKPLDNLTDI 464
224113327 391 DTLYAHANRQFYRECNIYGTVDFIFGNSAVVIQSSSILPRKPMQGQQNTITAQGKIDPNQNTGISIQNCTIWPYGDLSSV 470
224100545 390 DTLYTHANRQFYRECNIYGTVDFIFGNSAVVIQNSNILPRKPMEGQQNTITAQGRIDPNQNTGISIQNCTILPFGDLSSV 469
225465371 386 DSLYAHSHRQFYRECDIYGTVDFIFGNSAVVFQNCNILPKQPMPGQQNTITAQGKNDPNQNTGIAIQNCTILPSADLSSV 465
255549456 395 DTLYAHSNRQFYRECNIYGTVDFIFGNSAVVIQNCNILPRRTMPGQKNTITAQGRFDPNQNTGISIQNCTILPFDNLTSI 474
297829618 383 DTLYVHAQRQFYRDCTIMGTVDFIFGNSASVLQNCRILPRRPMKGQQNTITAQGRTDPNMNTGISIHRCNISPLGDLTDV 462
15228355  383 DTLYVHAQRQFYRECTIIGTVDFIFGNSASVLQSCRILPRRPMKGQQNTITAQGRTDPNMNTGISIHRCNISPLGDLTDV 462
15238377  385 DTMYAHAQRQFYRDCVILGTVDFIFGNAAVVFQKCEILPRRPMKGQQNTITAQGRKDPNQNTGISIHNCTIKPLDNLTDI 464
224113327 391 DTLYAHANRQFYRECNIYGTVDFIFGNSAVVIQSSSILPRKPMQGQQNTITAQGKIDPNQNTGISIQNCTIWPYGDLSSV 470
224100545 390 DTLYTHANRQFYRECNIYGTVDFIFGNSAVVIQNSNILPRKPMEGQQNTITAQGRIDPNQNTGISIQNCTILPFGDLSSV 469
225465371 386 DSLYAHSHRQFYRECDIYGTVDFIFGNSAVVFQNCNILPKQPMPGQQNTITAQGKNDPNQNTGIAIQNCTILPSADLSSV 465
255549456 395 DTLYAHSNRQFYRECNIYGTVDFIFGNSAVVIQNCNILPRRTMPGQKNTITAQGRFDPNQNTGISIQNCTILPFDNLTSI 474
297829618 383 DTLYVHAQRQFYRDCTIMGTVDFIFGNSASVLQNCRILPRRPMKGQQNTITAQGRTDPNMNTGISIHRCNISPLGDLTDV 462
297806485 472 QTFLGRPWKDFSTTVIMKSYMDKFINPKGWLPWTGYAAPYTIFYAEYLNSGPGASTKNRVKWKGLKTsLTNKEANKFTVK 551
15228355  463 MTFLGRPWKNFSTTVIMDSYLHGFIDRKGWLPWTGDSAPDTIFYGEYKNTGPGASTKNRVKWKGLRF-LSTKEANRFTVK 541
15238377  465 QTFLGRPWKDFSTTVIMKSFMDKFINPKGWLPWTGDTAPDTIFYAEYLNSGPGASTKNRVKWQGLKTsLTKKEANKFTVK 544
224113327 471 KTFLGRPWKNYSTTVFMRSMMGSLIDPAGWLPWTGNTAPPTIFYSEFENFGPGASTKNRVKWKGLKT-ITNKQASKFTVK 549
224100545 470 KTYLGRPWKNYSTTVFMRSMMGSLIDPAGWLPWIGDTAPPTIFYTEFENFGPGASTKNRVKWKGLKT-ITNKQASKFTVK 548
225465371 466 KTYLGRPWKNYSTTVYMHSMMGSLIDPAGWLPWTGTTAPNTIFYSEFQNFGPGSSTKNRVKWKGLRN-ITQKEASKFTVK 544
255549456 475 QTFLGRPWKNYSTTVYMHSMMGSLIDPSGWLPWTGNTAPPTIFYAEFQNFGPGSSTKNRVKWKGLKN-ITYKLASKFTAN 553
297829618 463 KTFLGRPWKNFSTTVIMDSYLHGFVDRKGWLPWTGDSAPDTIFYGEYKNTGAGASTKNRVKWKGLRF-LYTKEANRFTVK 541
15228355  463 MTFLGRPWKNFSTTVIMDSYLHGFIDRKGWLPWTGDSAPDTIFYGEYKNTGPGASTKNRVKWKGLRF-LSTKEANRFTVK 541
15238377  465 QTFLGRPWKDFSTTVIMKSFMDKFINPKGWLPWTGDTAPDTIFYAEYLNSGPGASTKNRVKWQGLKTsLTKKEANKFTVK 544
224113327 471 KTFLGRPWKNYSTTVFMRSMMGSLIDPAGWLPWTGNTAPPTIFYSEFENFGPGASTKNRVKWKGLKT-ITNKQASKFTVK 549
224100545 470 KTYLGRPWKNYSTTVFMRSMMGSLIDPAGWLPWIGDTAPPTIFYTEFENFGPGASTKNRVKWKGLKT-ITNKQASKFTVK 548
225465371 466 KTYLGRPWKNYSTTVYMHSMMGSLIDPAGWLPWTGTTAPNTIFYSEFQNFGPGSSTKNRVKWKGLRN-ITQKEASKFTVK 544
255549456 475 QTFLGRPWKNYSTTVYMHSMMGSLIDPSGWLPWTGNTAPPTIFYAEFQNFGPGSSTKNRVKWKGLKN-ITYKLASKFTAN 553
297829618 463 KTFLGRPWKNFSTTVIMDSYLHGFVDRKGWLPWTGDSAPDTIFYGEYKNTGAGASTKNRVKWKGLRF-LYTKEANRFTVK 541
297806485 552 PFIDGNNWLPATKVPFKSDF 571
15228355  542 PFIDGGRWLPATKVPFRSGL 561
15238377  545 PFIDGNNWLPATKVPFNSDF 564
224113327 550 AFIQGEEWLTGTGISYKPGL 569
224100545 549 AFIQGEGWLKGTGISYKPGL 568
225465371 545 SFIDGSKWISDAGVSFKPGL 564
255549456 554 AFLQGDKWIPESGVSYKPGL 573
297829618 542 PFIDGGRWLPATKVPYRSGL 561
15228355  542 PFIDGGRWLPATKVPFRSGL 561
15238377  545 PFIDGNNWLPATKVPFNSDF 564
224113327 550 AFIQGEEWLTGTGISYKPGL 569
224100545 549 AFIQGEGWLKGTGISYKPGL 568
225465371 545 SFIDGSKWISDAGVSFKPGL 564
255549456 554 AFLQGDKWIPESGVSYKPGL 573
297829618 542 PFIDGGRWLPATKVPYRSGL 561
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap