Conserved Protein Domain Family
PHA02519

?
PHA02519: PHA02519 
plasmid partition protein SopA; Reviewed
Statistics
?
PSSM-Id: 107201
View PSSM: PHA02519
Aligned: 3 rows
Threshold Bit Score: 813.86
Threshold Setting Gi: 33770537
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
33770537   1 MNLQSTLNSCIERGQTMTQAIARAQFGDDSPEARAITRRWGITEAAELVGVTPQTIRNGEDSGKLPPADMVTRGRVPQRA 80 
46402111   1 MSLINLLQECISRGQEMTQAIAIAQFGDDSPEARKITRRWGITEVADLIGVSPQAIRDAEKNGRLPPPDFELRGRVERRA 80 
9630492    1 MSLINLLKDCINRGQEMTRAIAIAQFGDDSPEARRITRRWGITEVADLIGVTPQAIRDAEKAGRLPAPDFEMRGRVERRA 80 
33770537  81 GYTIQQINDLRDHFGTRWKRPDGQDPVVLAIAAHKGGAYKTSTSVHTAQWLALQGLRVLLIDATDPQATASLYHGYVPDL 160
46402111  81 GYTIDQISHMRNIFGNPNQRPADKNPAVLAVMSHKGGVYKTSSAVHEAQWLALQGHRVLLIEGNDPQGTASMYHGYVPDL 160
9630492   81 GYTIDQISHMRSVFGNPNQRPDDKNPVVLSVMSHKGGVYKTSSAVHQAQWLALQGHRVLLVEGNDPQGTASMYHGYVPDL 160
33770537 161 HIHEDETLLPYYLGERDDAMYAIKPTCWPNLDIIPSCLAIHRIESELYPLHDAEKLPVAPHMMLRAAIESVWDSYDVVVL 240
46402111 161 HIHADDTLLPFYLGERDNAEYAIKPTCWPGLDIIPSCLALHRIETDLMQYHAQGKLPHPPHLMLRAAIESVWDNYDIIVI 240
9630492  161 HIHADDTLLPFYLGKRDNAEYAIKPTCWPGLDIIPSCLALHRIETDLMQYHSEGKLPHPPHLMLRAAIESVWDNYDIIVI 240
33770537 241 DSAPNLGIGTINVVCAADVIVVPTPAELYDYVSTLQFFTMLRDLMAGVDLGGFEPDVRVLITKFSNAVGSQSQWMDDHIR 320
46402111 241 DSAPNLGTGTINVVCAADIIVVATPAELFDYSSVLQFFTMLLDLLKTVDLGGFEPVVRLLLTKYSLTTGNQSRWMEEQIR 320
9630492  241 DSAPNLGTGTINVVCAADVIVVATPAELFDYASVLQFFTMLLDLLETVDLGGFEPVVRLLLTKYSLTNGNQSRWMEEQIR 320
33770537 321 DAWGSMVLKEVVRVTDEVGKGQVRMRTVFEQAANQRSTPNAWRNAVAIWEPVCAEIYNRLIKPRWEN 387
46402111 321 NTWGSMVLRQVVRVTDEVGKGQIKMRTVFEQAAYQRSTLNAWRNAVSIWEPVCQEIFDDLIKPRWEE 387
9630492  321 NTWGAMVLRQVVRVTDEVGKGQIKMRTVFEQAANQRSTLNAWRNAVEIWEPVCKEIFEDLIKPRWED 387
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap