Conserved Protein Domain Family
KOG4439

?
KOG4439: KOG4439 
KOG4439, RNA polymerase II transcription termination factor TTF2/lodestar, DEAD-box superfamily [Transcription, Replication, recombination and repair]
Statistics
?
PSSM-Id: 232368
View PSSM: KOG4439
Aligned: 7 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 21-Jun-2003
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
19923174  157 EKGDQLFDQKKEQKPEMMEKDLSSgLVPKKKQSVVQEKKQEEGAEIQCEAetgGTHKRDFSEIKSqqcqgNELTRPSASS 236  human
7298962     1 MESSSPSDTTEIHKQSCSIQDQSSvPVPDSSGEINNWMEPEPVDSLELSGg--KNLEHAMPLLLT-----YLDLSPTEYA 73   fruit fly
30581024   66 TAESEKSDESDNSQNSQESEDSEDdSVRPSARNTKRKPLGIPSDSEDEED---ELEQRALSPSTRm---sITGVRPQDLS 139  fruit fly
17540630   53 KSVNSPIVNTPSSTASHCTNSFAT-STPKSKSNAS-TRLGSSYGSSRSSSqnhESHDRSRSFVQYd---eNKPLTPISKK 127  Caenorhabditis el...
17561718      -------------------------------------------------------------------------------- Caenorhabditis el...
7508346    58 TDSSEPPRTIIDASLNSMASTVYT-STPNSKQSISRTGSSTTYGSSKCST---DDHYRSRSFIDNs---fEKPVTPITKK 130  Caenorhabditis el...
17566484      -------------------------------------------------------------------------------- Caenorhabditis el...
19923174  237 QEKSSGKSQDVQRESEplREKVTQLLPQNVHSHNSISKPQKGgplnkEYTNWEAKETKAKDGPSIQATQKSLPQGHFqer 316  human
7298962    74 DNESAIFVSASEYNEK--KAQIDQLVQKILTMEQQQRQLEEN-----ASETKELCDLKLHLEKLNARLEALGEFLDT--- 143  fruit fly
30581024  140 DDDSEIEYSDEVQEGPteAPTAEAVVPRYTTQFAGNIQNDLHst-igAADSEVLDDSSGSDVLILSNKETPIEILSStdd 218  fruit fly
17540630  128 LAESTDLRSKAQLRERllRKSLKQNAEDSSPTRAASGGGWGSsadvkKSPEVSTGLFETALSPIAKSDRRSSEYNSStfl 207  Caenorhabditis el...
17561718      -------------------------------------------------------------------------------- Caenorhabditis el...
7508346   131 LQESDEPRAKQQLRERllRKSIKQQS-DQDLTGGSSRSGWGtg---eNSSLESSDLINSHFSPIAKTFRHASDLDDS--- 203  Caenorhabditis el...
17566484      -------------------------------------------------------------------------------- Caenorhabditis el...
19923174  317 pethsvpapggpaaqaapaaPGLSlgEGREAATSsd---dEEEDDVVFVSSKPGSPLLFDSTLdletkenlqfPDRSVQR 393  human
7298962   144 --------------------LRLR--EDQQEIKI------EDNSELVDHTEQPKWSNLYSGLN----------RYRQKAN 185  fruit fly
30581024  219 dattnkenmsgppferpsksLSPRssAGASVVKTsknlsqPTIQAVLKQKTSPAAPRRSRIKS----------EDQKVVS 288  fruit fly
17540630  208 nvqkvatstaindiggreeiVDESfpAPRTTAKQddsdiiEVTPEKVVSNEKRKSGIAINLDDsdii---dvtPVKTTSS 284  Caenorhabditis el...
17561718    1 ----------------------------------------------------------MNVSD----------PSKNEYS 12   Caenorhabditis el...
7508346   204 --------------------MNTSppPNRSTLPSv-----ETSSGNSPQTPYPGSPEASPQPS----------PPKNTAS 248  Caenorhabditis el...
17566484      -------------------------------------------------------------------------------- Caenorhabditis el...
19923174  394 KVsPAsgvskkvepsdpVARRVYLTTQLKQKKSTLASVN-IQALPDKGQKLIKQIQELEEVLSGLTLSPEQGTNEKSnsq 472  human
7298962   186 HT-AAq----------fYQHKSNIIDSLKTLYEPIQPRPaIDDLEKQPALLLVRLLKHQQSCLKWMQFRERQKISGG--- 251  fruit fly
30581024  289 QVvYD------------EEMRKLAEKRVQVSDAEKLFEKvAHKLPDKGSQIMKRIDTLRRELAMDEQWISALRVQQSnvp 356  fruit fly
17540630  285 RPpEPqrprlptspinsEYAKLSYKELLAKKNKVMGLISlSLDLPDGGRRVIKQFQELDDEVERRKEMGLAEEIVDDded 364  Caenorhabditis el...
17561718   13 K----------------EIRRTVSSEIIGQSRSPMTLE----NQPVSPMTKRRRLENMDRTITEQMVE---DEIVA---- 65   Caenorhabditis el...
7508346   249 -----------------ELQKLSIKELEANKDKKLKLLKfSSNLPDNGARVKLQVDEITEEIERRIINGVTDTMVVDk-- 309  Caenorhabditis el...
17566484      -------------------------------------------------------------------------------- Caenorhabditis el...
19923174  473 vpqqsh-------------ftktttgppHLVPPQPLPRRGTQPVgsleLKSACQVTAGGSSQCYRGHTNQDHVHAVWKIT 539  human
7298962   252 ----------------------------ILADDMGLGKTLSMIAlilaSEETKNRKREEKKKALTLKWTQE-FNRVYCKE 302  fruit fly
30581024  357 -------------------------avrVVKPTLNPPRAPSIDTl---DWDELSEAVNEIKPVYTGAQGMATFNNQKALT 408  fruit fly
17540630  365 deifvieddepshrqvapkfpsgsvmtqNGLLPKRHIVDPLKAP----QPDFNAMLEKDNKKMMSGKMTDEKYKRIQLVS 440  Caenorhabditis el...
17561718   66 ----------------------------TAISPPSQPKNVVVPI----PQDFAAMLTNSWTKPIRGPMTEKKKLKINETF 113  Caenorhabditis el...
7508346   310 ---------------------------tTAIPPPPQPKNLIAPI----PQDFAAMLDKNGRKVMSGRMTEQKILKVNKIS 358  Caenorhabditis el...
17566484    1 ------------------------------------------------------------------MSDNENGENLNDEF 14   Caenorhabditis el...
19923174  540 SEAIGQLHRSLESCPGETVVAEDPAGLKVPLLLHQKQALAWLLWRESQKPQGGILADDMG--LGKTLTMIALILTQKNQE 617  human
7298962   303 IRKISMFDDEEESGK-EEEQYEPPEKRTCHVKTKKINQFRILDDDDNDAGDKAVVEDEQKdlLAKTP-EPEVFSSDEEEE 380  fruit fly
30581024  409 LESLKDLHVSLEDLPGPEVLAEDPVGLKVSLMNHQKHALAWMSWRERKLPRGGILADDMG--LGKTLTMISSVLACKNGQ 486  fruit fly
17540630  441 DRVVRQLAEATHTIPDETELTDTPKGFKLELMPHQKAGLTWMRWRETQPQPGGILADDMG--LGKTLSMISLIAHQKAAR 518  Caenorhabditis el...
17561718  114 NKLTQQLADATHTIPAETDLTETPDGFLVDLMPHQKAGLCWLLWRESQPHSGGILGGDMG--LGKTLSMISLIVHQKAAR 191  Caenorhabditis el...
7508346   359 DRLMQQLADATHTIPAETDLTDTPDGLLVELMPHQKAGLRWLVWREGQPHSGGILADDMG--LGKTLSMLSLIVHQKAAR 436  Caenorhabditis el...
17566484   15 DKCTLEDKKDIKKEP-CQDATPNGFVADFRLMPHQEAARDWMIDREAQEPSGGILGLAHG--QGKTAIVIALILDQKIKC 91   Caenorhabditis el...
19923174  618 KKEEKEKSTALtWlskddsc--------------dftshgTLIICPASLIHHWKNEVEKRVNSNKLRVYLYHGPN----- 678  human
7298962   381 HLSNGRYPSAN-----------------------------TLVVCPMSVMCQWAHEVASKVAQNAIRVLTFHGPNr---- 427  fruit fly
30581024  487 EMSEGKDESSDsDseddknkkrksvtgwkskgrkdtrrggTLVVCPASLLRQWESEVESKVSRQKLTVCVHHGNN----- 561  fruit fly
17540630  519 RARREDGNDDKdKekrkvvke-----------qglipsngTLIVAPASLIHQWDAEIDRRLDDSVLSTYMFHGTKk---q 584  Caenorhabditis el...
17561718  192 KTRKDAGDDA---------------------------------IAPESLVHHWEAEIARRLKQDLLSVLVYHGNR----- 233  Caenorhabditis el...
7508346   437 RARKESGDNAAdKekrrvake-----------eglypsngTLIIAPASLIHQWEAEINRRLESDLLSVFMFHGTKk---q 502  Caenorhabditis el...
17566484   92 ASNDKKFEQKS-P---------------------------TLIIVPKRIIYQWYDEFKDRLEENALSVYLYYDDEfsear 143  Caenorhabditis el...
19923174  679 RDSRARVLSTYDIVITTYSLVAk-------------eIPTNKQEaeipganlnVEGTSTPLLRIAWARIILDEAHNVKNP 745  human
7298962   428 HEIGIEAFRSYDLVITSYNLVVn------------------ELK---------RYGNTSPLFAVYWNRVILDEAHIIRNS 480  fruit fly
30581024  562 RETKGKYLRDYDIVVTTYQIVAr------------------------------EHKSLSAVFGVKWRRIILDEAHVVRNH 611  fruit fly
17540630  585 RDIDARRLARYDVVITTFNLIAneliekirtkskaddSSDGESDsnhtgirraVGKDDSVLAQICWSRVILDEAHTIKNR 664  Caenorhabditis el...
17561718  234 RHINPKDLKKH--IELDYDLEDe-------------hNPCSKLRprv---cpkADKNSSPLARIAWSYVILDEAHIIKNR 295  Caenorhabditis el...
7508346   503 RQIEPKELARYDVVITTYTLAAnelmekkaagskkeeDSDDESEneen-prrpAGKNDSPLARVAWSRVILDEAHAIKNR 581  Caenorhabditis el...
17566484  144 KNISASELQKYDVVLTTYRNVPv--------------kEKDETG---------EKVSKQVLQNIKWTRIVLDEAHNIRDS 200  Caenorhabditis el...
19923174  746 RVQTSIAVCKLQACARWAVTGTPIQNNLLDMYSLLKFLRCSPFDEFNLWRSQVDNGSKKGGERLSILTKSLLLRRTKDQL 825  human
7298962   481 KTNCCNSVCQLRAHCHWALTGTPVQNRGVDVFALLRFVNVPNFQDLQQWKKNLN-ESMLGHRRLNFIIKPLMLRRTKQKL 559  fruit fly
30581024  612 KSQSSLAVCDLRGKYRWALTGTPIQNKELDVYALLKFLRCSPFDDLHTWKKWIDNKSAGGQNRLNLLMKSLMLRRTKAQL 691  fruit fly
17540630  665 QSLASKAVCRLSAFSRWCLSGTPIHNNLWDLYSLVRFLRIRPFSDDKYWKESIMPMKPIMADRVNLLTKNLLLRRTKDQT 744  Caenorhabditis el...
17561718  296 NAQCSEAACKISAFSRWCLSGTPIHNN---------------------------------------------MRR----- 325  Caenorhabditis el...
7508346   582 LSQCSKAVCRLSSFSRWCLSGTPIHNNLWDLYSLVRFLRIPLFGDRKFWAESIMPMKTGMADRVNLLTKNLMLRRTKDQQ 661  Caenorhabditis el...
17566484  201 NTKKSTAIATLASKNRWCVTAAPFQNSEWDICNLILFLGNKPFG------ENVKGPEKTPENLKKLKESTMELFR----- 269  Caenorhabditis el...
19923174  826 DSt-GRPLVILPQRKFQLHHLKLSEDEETVYNVFFARSRSALQSYLKRHESRGNQSGRSPNN---PFSRVALEFGSE--- 898  human
7298962   560 QA--SGDMPALPSLKIELICVQLSKTEMAVYQILSAISKKIFTQFLLQREKGNSDLNYYSLErtpQFIAGHMSDERYnei 637  fruit fly
30581024  692 QS--DGKLNSLPNKELRLIEISLDKEEMNVYQTVMTYSRTLFAQFLHQRAERETDFNYRSDAnkpTYNQIKDPNGAYykm 769  fruit fly
17540630  745 CAvtNQKLVQLPPKNVEVHELELDGDEAQAYEIMMEAAKKFVKKLLQDSNDMKNHGFIPRRN---RRAGKEGEVQNPfnf 821  Caenorhabditis el...
17561718  326 -----KKIVHLMEKNIVIHKLEMVGQEAKGFAMMMEAALSLS-------------------------------------- 362  Caenorhabditis el...
7508346   662 CAltNKKIVNLKEKKIEIHELEMVGDEANGYAIMMEAAQKLVKQIVTNTDDIQKYGQI-RRR---RQRGNDDEFANPynv 737  Caenorhabditis el...
17566484  270 -G-------NNLVFNSIINTGELSANEKKAYDIIEDAHKRFCKK------------G-QS-------------------- 308  Caenorhabditis el...
19923174  899 EPRHsEAADSP--RSSTVH-ILSQLLRLRQCCCHL----SLLKSALDPMELKGEGLVLSLEE-QLSALTLSELRDSEPSS 970  human
7298962   638 YERFlKSLGYNpgEKILGIyILVLLLRLRQFCCHPglmiGMLRGALTAEDVQNVKVDASDVEgQLKMDVLAELDKFDETD 717  fruit fly
30581024  770 HEKFaRMAGSK--KEVKSHdILVLLLRLRQICCHP----GLIDAMLDGEESQTMGDHSSDSD-TPEIDLLAQLNKLAITD 842  fruit fly
17540630  822 GPRD-LAAGSN--FEKMSC-VLMLLLRLRQACVHF----NITKTGVDMDAFSLIGGDNAEEA-NVDDLNELLEKTMNMTL 892  Caenorhabditis el...
17561718  363 -P---------------------------------------------------NG----------------------LLF 368  Caenorhabditis el...
7508346   738 GPRN-LAGNSN--FQNMSC-ILLLLMRLRQACVHF----HITKSGMDLDAFKINGGDDEDAD-MKELENLMEKTMADLTI 808  Caenorhabditis el...
17566484  309 ---------------------LKLLAMLQQASIHF-----HNLAPEEPLKKAMDKFMDEEEKfKEEEKSFNMAEKNFETA 362  Caenorhabditis el...
19923174  971 TVSLN-----------------------------------GTF--FKMEL----------------FEGMRESTKISSLL 997  human
7298962   718 SEDDCcdeedstrrdgnfklevikdeikeenvpwdsgddlPTAssFEDQLdsaralkl-lnpqnpiFQFIRPSAKLKMVI 796  fruit fly
30581024  843 TSTDGqqsvan------------------------agddgPPL--LPDEAriakasknllkrsnpvFNLHRPSSKINMVI 896  fruit fly
17540630  893 GNGDNee-------------------------------rdKPR--ATTRI----------------FDPDYLSCKIKNTL 923  Caenorhabditis el...
17561718  369 C----------------------------------------------------------------------VSC------ 372  Caenorhabditis el...
7508346   809 ADSDNdeegvd------------------------tnkeePKQ--PPTRI----------------FEPDFISCKMAKTL 846  Caenorhabditis el...
17566484  363 CSDDE------------------------------------------KQA----------------FESAKTTFETAKEK 384  Caenorhabditis el...
19923174  998 AELEAIqRNSASQKSVIVSQWTNMLKVVALHLKKHGLTYATIDGSVNPKQRMDLVEAFNHSRG-PQVMLISLLAGGVGLN 1076 human
7298962   797 DKLEEL-LTGTNDKIIVTSQWVSYLAIVRKRLQDLSWETLDFNGQLTAKEREIVLRDFNANNE-KRVLLLSLTAGGVGLN 874  fruit fly
30581024  897 QILKTSiLKSSDDKAIVVSQWTSVLDILRDHLSKDGVATLSLNGTIPVKNRQDIVNEFNDRNNqKRVLLLSLTAGGVGLN 976  fruit fly
17540630  924 EIVENI--MEKKEKVVIVSQWTSVLNLIEIHIKSSGFKYTSITGQVLVKDRQERVDSFNREKGgARVMLLSLAAGGVGLN 1001 Caenorhabditis el...
17561718  373 -----------------------------KDIQEGGHGYTSITGEVAIKDRQERVDSFNQEKGgAQDMLLSLTAGGVGLN 423  Caenorhabditis el...
7508346   847 EVVREI--LEKKEKVVIVSQWTSVLNLVEKHIQAGGHNYTSITGQVLVKDRQERVDSFNQEKGgAQVMLLSLTAGGVGLN 924  Caenorhabditis el...
17566484  385 FTKATEeYTFSKETLKNVAKLAK--NGQFPKIGQFPEIFDIKHPNARITKTINIIQEVLMKKEkVTVSVVFLSERAGAIN 462  Caenorhabditis el...
19923174 1077 LTGGNHLFLLDMHWNPSLEDQACDRIYRVGQQKDVVIH--------RFVCEGTVEEKILQLQEKKKDLAKQVLS---GSG 1145 human
7298962   875 LNVANHMLIVDLHWNPQLERQAQDRIYRYGQTKPTFIY--------RYMCQDTVEQRIKSLQDCKLEIAKVVLPeegGEV 946  fruit fly
30581024  977 LIGANHLLLLDLHWNPQLEAQAQDRIYRVGQKKNVIIY--------KFMCVDTVEQRIKGLQDKKLDLADGVLT---GAK 1045 fruit fly
17540630 1002 LTGGNHLVMVDLHWNPALEQQAFDRIYRMGQKKDVFIH--------RLVTKGTIEQRVVMLQKDKVALASSVLD---GNA 1070 Caenorhabditis el...
17561718  424 LIGGNHLIMVDLHWNPALEQQACDRIYRMGQKKEVHIH--------RLIVKETIEQRVMSLQEKKLALAASVLE---GSA 492  Caenorhabditis el...
7508346   925 LIGGNHLIMVDLHWNPALEQQACDRIYRMGQKKEVFIHrlniskfcRLIVKGTIEQRVMDLQEKKLALAASVLE---GTA 1001 Caenorhabditis el...
17566484  463 LHGATHVILLGMHWNLALEQEACSCVCNIAQKNIVTIH--------RIKVAGTNEDDVEKAQDDKSDRSVGAET------ 528  Caenorhabditis el...
19923174 1146 E--SVTKLTLAHLRVLFGI 1162 human
7298962   947 TkcVGGGLNLAELKKLFEM 965  fruit fly
30581024 1046 V---SSKLTIDDLKGLFGM 1061 fruit fly
17540630 1071 Tr-KMNKLTTADIKMLFGL 1088 Caenorhabditis elegans
17561718  493 Tr-GMNKLTNSDIRTLFGL 510  Caenorhabditis elegans
7508346  1002 Tr-KLNKLTTADIRMLFGL 1019 Caenorhabditis elegans
17566484  529 ---PIRESTPISLKK---- 540  Caenorhabditis elegans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap