Conserved Protein Domain Family
KOG4422

?
KOG4422: KOG4422 
KOG4422, Uncharacterized conserved protein [Function unknown]
Statistics
?
PSSM-Id: 232351
View PSSM: KOG4422
Aligned: 4 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 21-Jun-2003
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
17510941   1 MGLGRVITRSLSSVEPALSQKLTIQPAIERSPTDLLNALSETVGPDTTAPHFAYIDDPITIPSTQSTKKTYFMAKEFGKR 80  Caenorhabditis elegans
7303339   16 ACSLSSSGAHYTTAAPAEDAPIEIPNRIERSPTDLLQALASTVARDYTAPHYKYHDDPFLIPMSNAAKRTYAMSKESGRK 95  fruit fly
21361666     --------------------------------------------------------------------------------     human
7021059      --------------------------------------------------------------------------------     human
17510941  81 AARELATEWPTLFAFDRDQPQLPVFRPRHLADPLQVEpTENNLLKMISSREVKDSCILYERMRSENVDVSEKVQLELFRL 160 Caenorhabditis elegans
7303339   96 AAKWIKEEHRELFMHQEAQPAIEKFAPSMVYTEDSVV-DETSLAQLISQGELKDAVLVYNLLEQKGNPISPELKQSLLEL 174 fruit fly
21361666     --------------------------------------------------------------------------------     human
7021059      --------------------------------------------------------------------------------     human
17510941 161 VTYYNSSNVP---FAEWEEFVGMRNFGEDSTSSWKSGAVAD-LLFETLPKTDETVSIMIAGLCKFsdhSSLERARELYKE 236 Caenorhabditis elegans
7303339  175 VCFHNNQEPIpeeYIEERWFLQNNKRRERSGKTWKDGDLAEkLYSEIEPKTPQSYASLIRGMAKY---LQCERAYALLQE 251 fruit fly
21361666     --------------------------------------------------------------------------------     human
7021059      --------------------------------------------------------------------------------     human
17510941 237 HRAAKGKVYREAFNGLIGASSYSVG---------KKLVAEMISLRMTPDIFTFNALLSSAAKAGKFEDRVKAFTEIIGEM 307 Caenorhabditis elegans
7303339  252 AGEKQVQLDTNTFNSVIEIVSFLKDtaeqrwqlcKDLLNEMSQQKLRPNLGTLNAVLQCISTFGNFKVARAAALQALPEF 331 fruit fly
21361666   1 ----------------------------------------MVAQKVKPNLQTFNTILKCLRRFH--VFARSPALQVLREM 38  human
7021059      --------------------------------------------------------------------------------     human
17510941 308 KEIGVEPALSSFHLIIKniidfklldNEKRESDEQKktynhqltVAISWLNEIQNSLTGKTLKPITSTCNLFFVEAMGIH 387 Caenorhabditis elegans
7303339  332 KQLGVNPSLGSYYYLLI---------IFCRERGP-----------VSHVIVDILNDISGKEFQIQHPKDTYFFATAMDVC 391 fruit fly
21361666  39 KAIGIEPSLATYHHIIR---------LFDQPGDPLK--------RSSFIIYDIMNELMGKRFSPKDPDDDKFFQSAMSIC 101 human
7021059    1 ------------------------------------------------------------------MMAYKFFQSAMSIC 14  human
17510941 388 Y-RAANENLAENLVSIYESKANEVKMPAFtIESMFYNRQLQLAVEQSASLNRIYDLYTTMVPRLVGVNNYLSSLVFRklA 466 Caenorhabditis elegans
7303339  392 RnHLHDKSLAKKVDELLHTGKNYDLVGDS-FKESIYYRNYLALLCQTESTEDFMLSYDLLVPNIYIPEPGIMEEILR--A 468 fruit fly
21361666 102 S-SLRDLELAYQVHGLLKTGDNWKFIGPD-QHRNFYYSKFFDLICLMEQIDVTLKWYEDLIPSAYFPHSQTMIHLLQ--A 177 human
7021059   15 S-SLRDLELAYQVHGLLKTGDNWKFIGPD-QHRNFYYSKFFDLICLMEQIDVTLKWYEDLIPSAYFPHSQTMIHLLQ--A 90  human
17510941 467 ASSDRHWPLLRRVIIDGIAAG-QMNGVIGEEMRKQLCNVQLHTLgTSEREQFTSLVQKLVAVWVEFSQFTEERMRrlQRK 545 Caenorhabditis elegans
7303339  469 IEINGAVEYVPRLWSDMVVFDhTHRESLLLYVLRILVDNKPNPD-SPAQAQLPEQGAKVALDMFERVEEAIKRLR--KVS 545 fruit fly
21361666 178 LDVANRLEVIPKIWKDSKEYGhTFRSDLREEILMLMARDK-HP---P---ELQVAFADCAADIKSAYESQPIRQT--AQD 248 human
7021059   91 LDVANRLEVIPKIWKDSKEYGhTFRSDLREEILMLMARDK-HP---P---ELQVAFADCAADIKSAYESQPIRQT--AQD 161 human
17510941 546 LSPSQISECALLLTRIGEQQKAYELLDLLLdetaSSGDEATVYPRGHArpwaMAELFEDALRKRDTYAAATCLQIMsLTA 625 Caenorhabditis elegans
7303339  546 FTGQMLGDILTLLVRGGSYEKATEVFAHID----KNQHRIPGTPSLNA----LIEFVDASVQEKSPSQALFALQYA-VEN 616 fruit fly
21361666 249 WPATSLNCIAILFLRAGRTQEAWKMLGLF-----RKHNKIPRSELLN-------ELMDSAKVSNSPSQAIEVVELA-SAF 315 human
7021059  162 WPATSLNCIAILFLRAGRTQEAWKMLGLF-----RKHNKIPRSELLN-------ELMDSAKVSNSPSQAIEVVELA-SAF 228 human
17510941 626 NRAKLEPLANRIFEKCNVNQEQVRIIQGFIRLRPQ 660 Caenorhabditis elegans
7303339  617 NFDSRE-LAKRIHEGFTLNETH---LSKLKSLVGE 647 fruit fly
21361666 316 SLPICEGLTQRVMSDFAINQEQKEALSNLTALTSD 350 human
7021059  229 SLPICEGLTQRVMSDFAINQEQKEALSNLTALTSD 263 human
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap