Conserved Protein Domain Family
KOG4163

?
KOG4163: KOG4163 
KOG4163, Prolyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]
Statistics
?
PSSM-Id: 232093
View PSSM: KOG4163
Aligned: 9 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 21-Jun-2003
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19112954  146 KTVFVSPAAVQTYLKSVgvNPIIVDFSAPGSATAPSKPAAQKKKAEPSKNd-------AAIENAALIGITVRKDADFPNW 218
gi 7301076  1156 LKAKYKEVTGTDFPVAGrgGGGGGGSAKKAPKEAQPKPAKPVKKEPAADAs-------GAVKKQTRLGLEATKEDNLPDW 1228
gi 15228692    1 -------------------MADPSEQKEKVVKEKKEKVKKEKVVKEKVAKasssgqkkKDVKKETGLGLSVKKDENFGEW 61
gi 15238286      --------------------------------------------------------------------------------
gi 15237183    4 SSLRLPSLTSLLFPATTryPATLRRTVCLRNRPLSGFATAPSGTASPETKs-------SEVDRLRSDRAVTPRSQDFNAW 76
gi 17555192   42 LKLTYKEVTGQEYAAPN-------ARQSKPKKEEKPKQ-QPKQQEKKQDG-----------KKQTLLGVGTKKDDNYSEW 102
gi 19074055    1 ------------------------------------MFWKGLKVHINIINy------lRPTMDKQKFGLTAKKEEDFSEW 38
gi 135104    876 veykpvsatgaedkdkkkkekenksekqnkpqkqndgqrkdpsknqggglsssgagegqgpkkqtrLGLEAKKEENLADW 955
gi 731640    119 DSTYMKKSDMMKFLNNFedSQKVVDFSQEVSKETATEGKKQQKKQQPSKAgtaaaaaaAALEDAKLIGITVDKALDFPGW 198
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19112954  219 YQQVLTKSDMIEYYDISGCYILKPWSYSIWEAIQGWFDKEIKKLGVRNGYFPLFVSSKVLEKEKDHVEGFAPEVAWVTRA 298
gi 7301076  1229 YSQVITKGEMIEYYDVSGCYILRQWSFAIWKAIKTWFDAEITRMGVKECYFPIFVSKAVLEKEKTHIADFAPEVAWVTKS 1308
gi 15228692   62 YSEVCKQ-DMIEYYDISGCYILRPWSMAIWEIMQIFFDAEIKKMKVKNCYFPLFVSPGVLEKEKDHIEGFAPEVAWVTKS 140
gi 15238286      --------------------------------------------------------------------------------
gi 15237183   77 YLDVIASAELADYGPVRGTMVIRPYGYAIWEAIQDYLNVKFKETGHSNMYFPQFIPYSFIEKEASHVEGFSPELALVTVG 156
gi 17555192  103 YSEVITKAEMIEYYDVSGCYVLRPWSFAVWESIQEWFDSGIKKLGVKNCYFPMFVSNAALEREKTHIADFAPEVAWVTRA 182
gi 19074055   39 YVQVITKGEMIDYYAIKGCYVMRPLGQFVWKCIHKWFTKKIEELGVQECYFPMLVPKSMLEMEKDHVENFSPEVAWITKC 118
gi 135104    956 YSQVITKSEMIEYHDISGCYILRPWAYAIWEAIKDFFDAEIKKLGVENCYFPMFVSQSALEKEKTHVADFAPEVAWVTRS 1035
gi 731640    199 YQQILTKGEMLDYYDVSGCYILRPPSYAIWENIQKWFDDKIKAIGVQNAYFPMFVSSRVLEKEKDHVEGFAPEVAWVTRA 278
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19112954  299 GTSELDEPIAIRPTSETVMYPYYAKWIRSHRDLPLKLNQWNSVVRWEFKNPQPFLRTREFLWQEGHTAHMTLEGATEEVH 378
gi 7301076  1309 GDSDLAEPIAVRPTSETVMYPAYAKWVQSYRDLPIRLNQWNNVVRWEFKQPTPFLRTREFLWQEGHTAFADKEEAAKEVL 1388
gi 15228692  141 GKSDLEVPIAIRPTSETVMYPYYSKWIRGHRDLPLKLNQWCNVVRWEFSNPTPFIRSREFLWQEGHTAFATKAEADEEVL 220
gi 15238286      --------------------------------------------------------------------------------
gi 15237183  157 GGKELEEKLVVRPTSETIVNHMFTQWIHSYRDLPLMINQWANVTRWEMR-TKPFIRTLEFLWQEGHTAHATPEEAEKEAK 235
gi 17555192  183 GNSEMAEPIAIRPTSETVMYPSYKKWVQSHRDLPIKLNQWCNVVRWEFKHPTPFLRTREFLWQEGHTAFANPADAEKEVF 262
gi 19074055  119 GNQVLEDPVAVRPTSETIIYPSFSKWIRSHRDLPLKLNQWCSVLRWELHGTLPFIRGKEFLWQEGHTAFLTRKESDEEVL 198
gi 135104   1036 GKTELAEPIAIRPTSETVMYPAYAKWVQSHRDLPIKLNQWCNVVRWEFKHPQPFLRTREFLWQEGHSAFATMEEAAEEVL 1115
gi 731640    279 GSSELEEPIAIRPTSETVMYPYYAKWVQSYRDLPLKLNQWNSVVRWEFKHPQPFLRTREFLWQEGHTAHLTAKDAEEEVL 358
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19112954  379 QILDLYARIYTDLLAVPVIKGVKSENEKFAGGMFTTTVEGYIPTTGRGIQGATSHCLGQNFSKMFNIVVEDPnaeigptG 458
gi 7301076  1389 DILDLYALVYTHLLAIPVVKGRKTEKEKFAGGDYTTTVEAFISASGRAIQGATSHHLGQNFSKMFEIVYEDPe------T 1462
gi 15228692  221 QILELYRRIYEEYLAVPVVKGMKSENEKFAGGLYTTSVEAFIPNTGRGVQGATSHCLGQNFAKMFEINFENE-------- 292
gi 15238286    1 ----MVKETRLGITAKKDEDFGKWYSEACRFGELVEYYESVKGCYILKPSGISDEYLERYTNTTLKGLLQRL-------- 68
gi 15237183  236 QMIEIYTRFAFEQTAIPVIPGRKSKLETFAGADITYTIEAMMGDR-KALQAGTSHNLGQNFSRAFGTQFADE-------- 306
gi 17555192  263 QILDLYAGVYTDLLAIPVVKGRKSEKEKFAGGDFTTTVEAYVACNGRGIQGATSHHLGQNFSKMFDISYEDPa------K 336
gi 19074055  199 AILDLYSQIYSELLAVPVIKGRKSENEKFGGADYTTSIEAFIPGSGRGVQAATSHSLGQNFSRMFDIKADTDe------G 272
gi 135104   1116 QILDLYAQVYEELLAIPVVKGRKTEKEKFAGGDYTTTIEAFISASGRAIQGGTSHHLGQNFSKMFEIVFEDPk------I 1189
gi 731640    359 QILDFYAGVYEELLAVPVVKGRKTEKEKFAGGDFTTTCEGYIPQTGRGIQGATSHHLGQNFSKMFNLSVENPl-----gS 433
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19112954  459 ERPKLFVWQNSWGLSTRTIGVAVMVHGDDKGLKLPPAIALVQSVVVPCGITNKTTDQERNEIEGFCSKLADRLNAADIRT 538
gi 7301076  1463 Q-QKKYVYQNSWGITTRTIGVMIMVHADNQGLVLPPHVACIQAIVVPCGITVNTKDDERAQLLDACKALEKRLVGGGVRC 1541
gi 15228692  293 KAETEMVWQNSWAYSTRTIGVMIMTHGDDKGLVLPPKVASVQVVVIPVPYKDAN----TQGIYDACTATASALCEAGIRA 368
gi 15238286   69 LGLQELVDKRTQGP---PFEAACMTHGDDKGLVFPPKVAPVQVVVIHVPIKGAAD---YQELCDACEAVESTLLGAGIRA 142
gi 15237183  307 NGERQHVWQTSWAVSTRFVGGIIMTHGDDTGLMLPPKIAPIQVVIVPIWKKDTE----KTGVLSAASSVKEALQTAGVRV 382
gi 17555192  337 EGERAFAWQNSWGLSTRTIGAMVMIHGDDKGLVLPPRVAAVQVIVVPVGF--KT--ENKQSLFDAVDKVTKDLVADGVKA 412
gi 19074055  273 SESSSFVYQNSWGITTRSIGIAAMIHSDNLGLVLPPRVAMTQVVIVPCGITTASSKDDTESLRAYINGVCVQLKNSGVRV 352
gi 135104   1190 PGEKQFAYQNSWGLTTRTIGVMTMVHGDNMGLVLPPRVACVQVVIIPCGITNALSEEDKEALIAKCNDYRRRLLSVNIRV 1269
gi 731640    434 DHPKIFAYQNSWGLSTRVIGVMVMIHSDNKGLVIPPRVSQFQSVVIPVGITKKTSEEQRKHIHETARSVESRLKKVGIRA 513
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19112954  539 EADLR-AYTPGYKFSHWEMKGVPLRLEYGPNDAKKNQVTAVRRDTFEKI------PVPLNNLEKGVSDLLAKIQTNMYET 611
gi 7301076  1542 EGDYRdNYSPGWKFNHWELKGVPLRLEVGPKDLKAQQLVAVRRDTVEKI------TIPLADVEKKIPALLETIHESMLNK 1615
gi 15228692  369 EEDLRdNYSPGWKYSDWEMKGVPLRIEIGPRDLENDQVRTVRRDNGVKE------DIPRGSLVEHVKELLEKIQQNMYEV 442
gi 15238286  143 EADIRdNYSCGWKYADQELTGVPLRIETGPRDLANDQVRIVTRDNGAKM------DVKRGDLIEQVKDLLEKIQSNLYDV 216
gi 15237183  383 KLDDTdQRTPGWKFNFWEMKGIPLRIEIGPRDVSSNSVVVSRRDVPGKAgkvfgiSMEPSTLVAYVKEKLDEIQTSLLEK 462
gi 17555192  413 EHDLReNYNAGWKFNHWELKGVPIRFEVGPNDLAKNQVTAVIRHNGEKK------QLSLEGLSKTVKSLLDEIHTAMYNK 486
gi 19074055  353 HLDDRsNVTAGFKFNHWEIRGVPLRLEIGFKDMASSEACLVRRDTRAKK------QVSVEGIAHTVMEEIDTMHNDMLAR 426
gi 135104   1270 RADLRdNYSPGWKFNHWELKGVPIRLEVGPRDMKSCQFVAVRRDTGEKL------TVAENEAETKLQAILEDIQVTLFTR 1343
gi 731640    514 FGDYNdNYTPGWKFSQYELKGIPIRIELGPKDIEKNQVVVVRRNDSKKY------VVSFDELEARIPEILEEMQGDLFKK 587
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19112954  612 AKAERDAHVVKVKEWADFVPALNKKNIVMIPWCNTTECEKEIKKNSARQVNGDEped-ekAPSMGAKSLCIPLEQPsged 690
gi 7301076  1616 AQEDMTSHTKKVTNWTDFCGFLEQKNILLAPFCGEISCEDKIKADSARGEEAEPg-----APAMGAKSLCIPFDQPap-- 1688
gi 15228692  443 AKQKREACVQEVKTWDEFIKALNEKKLILAPWCDEEEVERDVKARTKG-ETG------------AAKTLCSPFDQP---- 505
gi 15238286  217 AKRKVEECTQKVETWDEFVEALSQKKLILAPWCDKVEVEKDVKRRTRGDETGGG--------GGGAKTLCTPLEQP---- 284
gi 15237183  463 ALSFRDSNIVDVNSYAELKDAISSGKWARGPWSASDADEQRVKEET------------------GATIRCFPFEQT---- 520
gi 17555192  487 VLAQRDSHLKSTTCIEEFKKLLDEKCIILSPFCGRPDCEEEIKKASTR-EDGEg------A-QMGAKTLCIPLDQPk--- 555
gi 19074055  427 ATSERDSRISYVKSFEEFMSALDNKNIIMAPWCGISECEIEIKSRSTRADPRSD------VVSTGAKTLCIPYGSKp--- 497
gi 135104   1344 ASEDLKTHMVVANTMEDFQKILDSGKIVQIPFCGEIDCEDWIKKTTARDQDLEPg-----APSMGAKSLCIPFKPLce-- 1416
gi 731640    588 AKELFDTHRVIVNEWSGFVPALNKKNVILAPWCGVMECEEDIKESSAKKDDGEEfeeddkAPSMGAKSLCIPFDQPvl-- 665
                        570       580
                 ....*....|....*....|....*....
gi 19112954  691 aiiEGTTKCAG--CGNLA-KVWGLFGRSY 716
gi 7301076  1689 --iAASDKCINpsCTNKP-KFYTLFGRSY 1714
gi 15228692  506 ---ELPEGTLCfaSGKPA-KKWTYWGRSY 530
gi 15238286  285 ---ELGEETLCfaSGKPA-KKWSYWGRSY 309
gi 15237183  521 ---QGTKTCLM--TGNPA-EEVAIFAKSY 543
gi 17555192  556 --qELPSKCLFpsCTYNA-KAFALFGRSY 581
gi 19074055  498 ---CDGMKCIN--CNSQA-VHYTLFGRSY 520
gi 135104   1417 --lQPGAKCV---CGKNPaKYYTLFGRSY 1440
gi 731640    666 --nEGQ-KCIK--CERIA-VNYCMFGRSY 688
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap